4KS7: PAK6 kinase domain

PAK6 kinase domain in complex with PF-3758309. Determined by X-ray diffraction at 1.4 Å resolution. Released 11 Sept 2013.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,680
Mol. weight: 33.85 kDa
Ligands: IPA, 7KC
Released: 11 Sept 2013

Explore 4KS7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KS7 contains 21 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	387-395	9
α-helix	399	1
α-helix	404-406	3
β-strand	407-416	10	1
β-strand	419-426	8	1
β-strand	432-439	8	1
α-helix	446-448	3
α-helix	449-458	10
β-strand	464	1	2
β-strand	467-473	7	1
β-strand	476-481	6	1
β-strand	487-488	2	2
α-helix	489-493	5
α-helix	497-499	3
α-helix	500-519	20
β-strand	522-523	2	3
α-helix	529-531	3
β-strand	532-534	3	2
β-strand	540-542	3	2
α-helix	545-547	3
β-strand	549-550	2	3
β-strand	558	1	4
α-helix	565-567	3
α-helix	570-573	4
β-strand	578	1	4
α-helix	581-596	16
α-helix	606-615	10
α-helix	618-619	2
α-helix	624-626	3
α-helix	629-638	10
α-helix	647-648	2
α-helix	649-653	5
α-helix	656-660	5
α-helix	664-670	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase PAK 6	A	protein	292	Homo sapiens	Q9NQU5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4KS7_1 Serine/threonine-protein kinase PAK 6 (chains A)
GSVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRK
QQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVLMEFLQGGALTDIVSQVRLNEEQ
IATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRVKLSDFGFCAQISKDVPKRKSLV
GTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRLRDSPPPKLK
NSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLY

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	1
7KC	PF-3758309	C25 H30 N8 O S	1

Primary citation

Substrate and Inhibitor Specificity of the Type II p21-Activated Kinase, PAK6. Gao, J., Ha, B.H., Lou, H.J. et al. PLoS One (2013) 8:e77818-e77818. DOI 10.1371/journal.pone.0077818 · PubMed

Other PDB entries of the same protein (UniProt Q9NQU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C30 1.6 Å, Crystal Structure Of The Human P21-Activated Kinase 6
6QDR 1.61 Å, Crystal structure of 14-3-3sigma in complex with a PAK6 pT99 phosphopeptide
6QDS 1.72 Å, Crystal structure of 14-3-3sigma in complex with a PAK6 pT99 phosphopeptide stabilized…
4KS8 1.95 Å, PAK6 kinase domain in complex with sunitinib
2ODB 2.4 Å, The crystal structure of human cdc42 in complex with the CRIB domain of human…

Browse structure collections

About this viewer

MolViewer shows 4KS7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.