Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D at pH 7 and cryogenic temperature. Determined by X-ray diffraction at 1.4 Å resolution. Released 12 Jun 2013.
Explore 4KY5 in 3D Show helices and sheets RCSB PDB PDBe
4KY5 contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-19 | 11 | 1 |
| β-strand | 22-27 | 6 | 1 |
| β-strand | 30-36 | 7 | 1 |
| β-strand | 39-40 | 2 | 2 |
| α-helix | 41-43 | 3 | |
| α-helix | 55-68 | 14 | |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 82 | 1 | 1 |
| β-strand | 88-94 | 7 | 1 |
| β-strand | 97-98 | 2 | 1 |
| α-helix | 99-105 | 7 | |
| β-strand | 110-111 | 2 | 2 |
| α-helix | 122-134 | 13 | |
| α-helix | 138-140 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thermonuclease | A | protein | 143 | Staphylococcus aureus | P00644 (AlphaFold model) |
>4KY5_1 Thermonuclease (chains A) ATSTKKLHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMV ENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR KAEAQAKKEKLNIWSEDNADSGQ
Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D at pH 7 and cryogenic temperature. Robinson, A.C., Schlessman, J.L., Heroux, A. et al. To be published.
Other PDB entries of the same protein (UniProt P00644 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4KY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.