Crystal structures of human p70S6K1-T389A (form II). Determined by X-ray diffraction at 2.9 Å resolution. Released 24 Jul 2013.
Explore 4L44 in 3D Show helices and sheets RCSB PDB PDBe
4L44 contains 15 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 65-67 | 3 | |
| β-strand | 68-76 | 9 | 1 |
| β-strand | 80-87 | 8 | 1 |
| β-strand | 96-103 | 8 | 1 |
| α-helix | 111-126 | 16 | |
| β-strand | 132 | 1 | 2 |
| α-helix | 133-134 | 2 | |
| β-strand | 135-141 | 7 | 1 |
| β-strand | 144-150 | 7 | 1 |
| β-strand | 156 | 1 | 2 |
| α-helix | 159-164 | 6 | |
| α-helix | 169-188 | 20 | |
| α-helix | 198-200 | 3 | |
| β-strand | 201-203 | 3 | 2 |
| β-strand | 209-211 | 3 | 2 |
| α-helix | 239-242 | 4 | |
| α-helix | 250-265 | 16 | |
| α-helix | 275-284 | 10 | |
| α-helix | 295-304 | 10 | |
| α-helix | 319-323 | 5 | |
| α-helix | 327-329 | 3 | |
| α-helix | 334-339 | 6 | |
| α-helix | 343-344 | 2 | |
| α-helix | 347-349 | 3 | |
| β-strand | 390-391 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RPS6KB1 protein | A | protein | 346 | Homo sapiens | P23443 (AlphaFold model) |
>4L44_1 RPS6KB1 protein (chains A) GAMSETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIV RNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFM EDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTH TFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLN LPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKP LLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFAYVAPS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| 5FI | 2-{[4-(5-ethylpyrimidin-4-yl)piperazin-1-yl]methyl}-5-(trifluoromethyl)-1H-benz… | C19 H21 F3 N6 | 1 |
Water and common crystallization additives (SO4) are not listed.
Crystal structures of S6K1 provide insights into the regulation mechanism of S6K1 by the hydrophobic motif. Wang, J., Zhong, C., Wang, F. et al. Biochem J (2013) 454:39-47. DOI 10.1042/BJ20121863 · PubMed
Other PDB entries of the same protein (UniProt P23443 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4L44 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.