Crystal structures of human p70S6K1-T389E. Determined by X-ray diffraction at 2.9 Å resolution. Released 24 Jul 2013.
Explore 4L45 in 3D Show helices and sheets RCSB PDB PDBe
4L45 contains 15 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 65-67 | 3 | |
| β-strand | 68-76 | 9 | 1 |
| β-strand | 80-87 | 8 | 1 |
| β-strand | 96-103 | 8 | 1 |
| α-helix | 104-107 | 4 | |
| α-helix | 111-126 | 16 | |
| β-strand | 132 | 1 | 2 |
| α-helix | 133-134 | 2 | |
| β-strand | 135-140 | 6 | 1 |
| β-strand | 144-150 | 7 | 1 |
| β-strand | 155-156 | 2 | 2 |
| α-helix | 157-164 | 8 | |
| α-helix | 169-188 | 20 | |
| β-strand | 201-203 | 3 | 2 |
| β-strand | 209-211 | 3 | 2 |
| α-helix | 216-217 | 2 | |
| α-helix | 239-242 | 4 | |
| α-helix | 250-265 | 16 | |
| α-helix | 275-284 | 10 | |
| α-helix | 295-304 | 10 | |
| α-helix | 320-324 | 5 | |
| α-helix | 327-329 | 3 | |
| α-helix | 334-338 | 5 | |
| α-helix | 343-344 | 2 | |
| β-strand | 390-391 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RPS6KB1 protein | A | protein | 346 | Homo sapiens | P23443 (AlphaFold model) |
>4L45_1 RPS6KB1 protein (chains A) GAMSETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIV RNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFM EDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTH TFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLN LPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKP LLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFEYVAPS
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5FI | 2-{[4-(5-ethylpyrimidin-4-yl)piperazin-1-yl]methyl}-5-(trifluoromethyl)-1H-benz… | C19 H21 F3 N6 | 1 |
Crystal structures of S6K1 provide insights into the regulation mechanism of S6K1 by the hydrophobic motif. Wang, J., Zhong, C., Wang, F. et al. Biochem J (2013) 454:39-47. DOI 10.1042/BJ20121863 · PubMed
Other PDB entries of the same protein (UniProt P23443 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4L45 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.