4L6R: PDB entry 4L6R

Structure of the class B human glucagon G protein coupled receptor. Determined by X-ray diffraction at 3.3 Å resolution. Released 24 Jul 2013.

Method: X-ray diffraction
Resolution: 3.3 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 3,056
Mol. weight: 48.26 kDa
Released: 24 Jul 2013

Explore 4L6R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4L6R contains 27 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 0 β-strands

Element	Residues	Length
α-helix	1003-1019	17
α-helix	1023-1040	18
α-helix	1046-1048	3
α-helix	1056-1080	25
α-helix	1084-1091	8
α-helix	1094-1097	4
α-helix	1098-1102	5
α-helix	1103-1105	3
α-helix	127-163	37
α-helix	173-176	4
α-helix	180-197	18
α-helix	218-221	4
α-helix	227-247	21
α-helix	250-254	5
α-helix	263-266	4
α-helix	271-273	3
α-helix	274-277	4
α-helix	281-289	9
α-helix	301-306	6
α-helix	308-329	22
α-helix	331-334	4
α-helix	343-351	9
α-helix	357-361	5
α-helix	375-390	16
α-helix	392-396	5
α-helix	397-402	6
α-helix	405-428	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562 and Glucagon receptor chimera	A	protein	425	Escherichia coli, Homo sapiens	P0ABE7 (AlphaFold model), P47871 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4L6R_1 Soluble cytochrome b562 and Glucagon receptor chimera (chains A)
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKD
FRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLMDGEEIEVQKEVAK
MYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDG
LLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLA
TLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAIL
INFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGT
LRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERNTSNGRPL
EVLFQ

Primary citation

Structure of the human glucagon class B G-protein-coupled receptor. Siu, F.Y., He, M., de Graaf, C. et al. Nature (2013) 499:444-449. DOI 10.1038/nature12393 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 4L6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.