Ca2+-bound MthK RCK domain at 2.5 Angstrom. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Oct 2013.
Explore 4L73 in 3D Show helices and sheets RCSB PDB PDBe
4L73 contains 27 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 118-121 | 4 | 1 |
| α-helix | 125-133 | 9 | |
| β-strand | 139-143 | 5 | 1 |
| α-helix | 146-148 | 3 | |
| α-helix | 149-153 | 5 | |
| β-strand | 158-161 | 4 | 1 |
| α-helix | 167-172 | 6 | |
| β-strand | 180-183 | 4 | 1 |
| α-helix | 188-201 | 14 | |
| β-strand | 207-210 | 4 | 1 |
| α-helix | 214-216 | 3 | |
| α-helix | 217-223 | 7 | |
| β-strand | 227-229 | 3 | 1 |
| α-helix | 231-240 | 10 | |
| α-helix | 247-256 | 10 | |
| β-strand | 263-268 | 6 | 2 |
| β-strand | 273 | 1 | 3 |
| β-strand | 279 | 1 | 4 |
| α-helix | 280-283 | 4 | |
| α-helix | 285-289 | 5 | |
| β-strand | 292-298 | 7 | 2 |
| β-strand | 301-304 | 4 | 2 |
| β-strand | 311 | 1 | 4 |
| β-strand | 317-322 | 6 | 2 |
| α-helix | 324-333 | 10 | |
| α-helix | 335 | 1 | |
| β-strand | 336 | 1 | 3 |
| α-helix | 337 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 118-121 | 4 | 5 |
| α-helix | 125-133 | 9 | |
| β-strand | 139-143 | 5 | 5 |
| α-helix | 146-148 | 3 | |
| α-helix | 149-154 | 6 | |
| β-strand | 158-161 | 4 | 5 |
| α-helix | 167-170 | 4 | |
| α-helix | 171-173 | 3 | |
| β-strand | 180-183 | 4 | 5 |
| α-helix | 188-201 | 14 | |
| β-strand | 206-210 | 5 | 5 |
| α-helix | 214-216 | 3 | |
| α-helix | 217-223 | 7 | |
| β-strand | 227-229 | 3 | 5 |
| α-helix | 231-240 | 10 | |
| α-helix | 247-256 | 10 | |
| β-strand | 263-268 | 6 | 6 |
| β-strand | 279 | 1 | 7 |
| α-helix | 280-283 | 4 | |
| α-helix | 285-289 | 5 | |
| β-strand | 292-298 | 7 | 6 |
| β-strand | 301-304 | 4 | 6 |
| β-strand | 311 | 1 | 7 |
| β-strand | 317-322 | 6 | 6 |
| α-helix | 324-333 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium-gated potassium channel MthK | A, B | protein | 242 | Methanothermobacter thermautotrophicus | O27564 (AlphaFold model) |
>4L73_1 Calcium-gated potassium channel MthK (chains A, B) MGLIDVAKSRHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTR VSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGAD QVISPFVISGRLMSRSIDDGYEAMFVQDVLAEESTRRMVEVPIPEGSKLEGVSVLDADIH DVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVPRGSHHHH HH
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 5 |
Water and common crystallization additives (CL, NA) are not listed.
Structural basis of allosteric interactions among Ca(2+)-binding sites in a K(+) channel RCK domain. Smith, F.J., Pau, V.P., Cingolani, G. et al. Nat Commun (2013) 4:2621-2621. DOI 10.1038/ncomms3621 · PubMed
Other PDB entries of the same protein (UniProt O27564 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4L73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.