4L75: Ca2+-bound D184N mutant MthK RCK domain

Ca2+-bound D184N mutant MthK RCK domain at 2.4 Angstrom. Determined by X-ray diffraction at 2.39 Å resolution. Released 23 Oct 2013.

Method

X-ray diffraction

Resolution

2.39 Å

Organism

Methanothermobacter thermautotrophicus

Chains

6

Atoms

10,580

Mol. weight

161.56 kDa

Ligands

CA

Released

23 Oct 2013

Explore 4L75 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4L75 contains 77 α-helices and 80 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 14 β-strands

Molecules and chains

>4L75_1 Calcium-gated potassium channel MthK (chains A, B, C, D, E, F)
MGLIDVAKSRHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTR
VSDLEKANVRGARAVIVNLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGAD
QVISPFVISGRLMSRSIDDGYEAMFVQDVLAEESTRRMVEVPIPEGSKLEGVSVLDADIH
DVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVPRGSHHHH
HH

Ligands and cofactors

Primary citation

Structural basis of allosteric interactions among Ca(2+)-binding sites in a K(+) channel RCK domain. Smith, F.J., Pau, V.P., Cingolani, G. et al. Nat Commun (2013) 4:2621-2621. DOI 10.1038/ncomms3621 · PubMed

Related structures

Other PDB entries of the same protein (UniProt O27564 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 3LDC 1.45 Å, High resolution open MthK pore structure crystallized in 100 mM K+
• 3LDD 1.45 Å, High resolution open MthK pore structure crystallized in 100 mM K+ and further soaked in…
• 6U9T 1.55 Å, Wild-type MthK pore in 50 mM K+
• 4HYO 1.65 Å, Crystal Structure of MthK Pore
• 6U9P 1.65 Å, Wild-type MthK pore in ~150 mM K+
• 2AEF 1.7 Å, Crystal Structures of the MthK RCK Domain in Ca2+ bound form
• 4HZ3 1.7 Å, MthK pore crystallized in presence of TBSb
• 3OUS 1.75 Å, MthK channel pore T59A mutant
• 3R65 1.8 Å, MthK channel pore E92Q mutant
• 6U9Y 1.8 Å, Wild-type MthK pore in 11 mM K+
• 4L74 1.84 Å, Ca2+-bound MthK RCK domain at 1.9 Angstrom with single ligand
• 6U9Z 1.95 Å, Wild-type MthK pore in 6 mM K+

Browse structure collections

About this viewer

MolViewer shows 4L75 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.