4LI2: Lgr4 and its complex with R-spondin1

Crystal Structures of Lgr4 and its complex with R-spondin1. Determined by X-ray diffraction at 3.19 Å resolution. Released 7 Aug 2013.

Method: X-ray diffraction
Resolution: 3.19 Å
Organisms: Xenopus (Silurana) tropicalis, Homo sapiens
Chains: 2
Atoms: 4,027
Mol. weight: 59.7 kDa
Released: 7 Aug 2013

Explore 4LI2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LI2 contains 3 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	37-38	2	1
β-strand	44-45	2	1
β-strand	65-66	2	1
β-strand	74-75	2	2
β-strand	88-90	3	1
β-strand	98-99	2	2
β-strand	112-114	3	1
β-strand	122	1	3
β-strand	136-138	3	1
β-strand	146	1	3
β-strand	160-162	3	1
α-helix	173-176	4
β-strand	184-186	3	1
β-strand	194-195	2	4
β-strand	208-210	3	1
β-strand	218-219	2	4
β-strand	232-234	3	1
α-helix	245-249	5
β-strand	255-257	3	1
β-strand	265-266	2	5
β-strand	279-281	3	1
β-strand	289-290	2	5
β-strand	303-306	4	1
β-strand	326-329	4	1
β-strand	350-352	3	1
β-strand	372-374	3	1
β-strand	382-383	2	6
β-strand	396-398	3	1
β-strand	406-407	2	6
α-helix	408-410	3
β-strand	420-422	3	1
β-strand	441-443	3	1

Chain B: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	44-47	4	7
β-strand	53-56	4	7
β-strand	61-63	3	8
β-strand	74-76	3	8
β-strand	83-84	2	9
β-strand	95-96	2	9
β-strand	102-105	4	10
β-strand	111-114	4	10
β-strand	119-121	3	11
β-strand	124-126	3	11
β-strand	135	1	12
β-strand	142	1	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat-containing G-protein coupled receptor 4	A	protein	432	Xenopus (Silurana) tropicalis	B0BLW3 (AlphaFold model)
R-spondin-1	B	protein	112	Homo sapiens	Q2MKA7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LI2_1 Leucine-rich repeat-containing G-protein coupled receptor 4 (chains A)
SGVSSPAPCPAPCACDLDGGADCSGKGLVTVPDGLSVFTHSLDLSMNNITKLPEGAFKGF
PYLEELRLAGNDLSIIHPMALSGLKELKVLTLQNNQLKTVPSESLKGLVSLQSLRLDANH
IVTVPEDSFEGLVQLRHLWLDDNSLTEVPIRPLSNLPSLQALTLALNKISHIPDYAFSNL
SSLVVLHLHNNKIRTLGPHSFHGLDNLEALDLNYNNLIDFPDSIRSLPNLKELGFHSNSI
TIIPDGAFVKNPLLRTIHLYDNPLSFVGNSAFQNLSDLHFLIIRGASNVQWFPNLTGTNN
LESLTLTGTKIRSIPIKFCQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEV
QNETFQGLAALRMLDLSRNRIHTIHKEAFVTLKALTNLDLSFNDLTAFPTAGLHGLNQLK
LTGNPNFKETLT

Sequence of entity 2 (B), FASTA

>4LI2_2 R-spondin-1 (chains B)
SAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMN
KCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSS

Primary citation

Crystal structures of lgr4 and its complex with R-spondin1. Xu, K., Xu, Y., Rajashankar, K.R. et al. Structure (2013) 21:1683-1689. DOI 10.1016/j.str.2013.07.001 · PubMed

Other PDB entries of the same protein (UniProt B0BLW3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LI1 2.66 Å, Crystal Structures of Lgr4 and its complex with R-spondin1

Browse structure collections

About this viewer

MolViewer shows 4LI2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.