Crystal structure of the catalytic subunit of yeast primase. Determined by X-ray diffraction at 1.63 Å resolution. Released 18 Dec 2013.
Explore 4LIM in 3D Show helices and sheets RCSB PDB PDBe
4LIM contains 27 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-21 | 10 | |
| α-helix | 25-33 | 9 | |
| α-helix | 40-43 | 4 | |
| β-strand | 45-50 | 6 | 1 |
| β-strand | 56-60 | 5 | 1 |
| α-helix | 65-75 | 11 | |
| β-strand | 79-86 | 8 | 1 |
| β-strand | 103-105 | 3 | 1 |
| β-strand | 108-113 | 6 | 2 |
| α-helix | 114-120 | 7 | |
| α-helix | 131-146 | 16 | |
| α-helix | 147-151 | 5 | |
| β-strand | 157-161 | 5 | 2 |
| β-strand | 166-171 | 6 | 2 |
| α-helix | 174-177 | 4 | |
| α-helix | 181-191 | 11 | |
| α-helix | 209-210 | 2 | |
| α-helix | 211-223 | 13 | |
| α-helix | 224-232 | 9 | |
| α-helix | 238-240 | 3 | |
| α-helix | 241-245 | 5 | |
| α-helix | 246-248 | 3 | |
| α-helix | 252-264 | 13 | |
| α-helix | 270-284 | 15 | |
| α-helix | 290-309 | 20 | |
| β-strand | 313 | 1 | 2 |
| α-helix | 315-319 | 5 | |
| β-strand | 325-326 | 2 | 1 |
| α-helix | 327 | 1 | |
| α-helix | 330 | 1 | |
| β-strand | 331 | 1 | 3 |
| α-helix | 332 | 1 | |
| β-strand | 337 | 1 | 4 |
| β-strand | 338 | 1 | 3 |
| β-strand | 341-342 | 2 | 2 |
| α-helix | 348-350 | 3 | |
| α-helix | 352 | 1 | |
| β-strand | 353 | 1 | 4 |
| α-helix | 354-363 | 10 | |
| α-helix | 367-369 | 3 | |
| α-helix | 373-391 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA primase small subunit | A | protein | 391 | Saccharomyces cerevisiae | P10363 (AlphaFold model) |
>4LIM_1 DNA primase small subunit (chains A) GANGPSSSDMEYYYKSLYPFKHIFNWLNHSPKPSRDMINREFAMAFRSGAYKRYNSFNSV QDFKAQIEKANPDRFEIGAIYNKPPRERDTLLKSELKALEKELVFDIDMDDYDAFRTCCS GAQVCSKCWKFISLAMKITNTALREDFGYKDFIWVFSGRRGAHCWVSDKRARALTDVQRR NVLDYVNVIRDRNTDKRLALKRPYHPHLARSLEQLKPFFVSIMLEEQNPWEDDQHAIQTL LPALYDKQLIDSLKKYWLDNPRRSSKEKWNDIDQIATSLFKGPKQDSHIIKLRECKEDLV LMTLYPKLDVEVTKQTIHLLKAPFCIHPATGNVCVPIDESFAPEKAPKLIDLQTEMEKNN DVSLTALQPFINQFQAYVSSLLKNELGSVKR
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Insights into Eukaryotic Primer Synthesis from Structures of the p48 Subunit of Human DNA Primase. Vaithiyalingam, S., Arnett, D.R., Aggarwal, A. et al. J Mol Biol (2014) 426:558-569. DOI 10.1016/j.jmb.2013.11.007 · PubMed
Other PDB entries of the same protein (UniProt P10363 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.