8FOK: DNA polymerase

Cryo-EM structure of S. cerevisiae DNA polymerase alpha-primase complex in the DNA elongation state. Determined by electron microscopy at 3.56 Å resolution. Released 31 May 2023.

Method: Electron microscopy
Resolution: 3.56 Å
Organisms: Saccharomyces cerevisiae, synthetic construct
Chains: 6
Atoms: 18,827
Mol. weight: 367.25 kDa
Ligands: SF4
Released: 31 May 2023

Explore 8FOK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FOK contains 137 α-helices and 99 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 54 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	353-362	10	1
β-strand	365-373	9	1
β-strand	379-386	8	1
β-strand	390-397	8	2
α-helix	398	1
α-helix	403-418	16
β-strand	425-431	7	2
β-strand	442-451	10	2
α-helix	461-463	3
β-strand	471-475	5	2
α-helix	481-488	8
β-strand	496-498	3	1
β-strand	503	1	1
β-strand	515-519	5	1
β-strand	526-527	2	1
β-strand	536-548	13	3
β-strand	553-567	15	3
α-helix	572-574	3
α-helix	577-579	3
β-strand	581-586	6	3
α-helix	594-595	2
α-helix	598-605	8
β-strand	609-612	4	3
α-helix	616-630	15
β-strand	634-637	4	3
α-helix	640-644	5
α-helix	645-655	11
α-helix	660-663	4
α-helix	683-690	8
β-strand	695-698	4	3
α-helix	702-707	6
α-helix	716-719	4
α-helix	720-724	5
α-helix	739-742	4
α-helix	745-767	23
α-helix	770-781	12
α-helix	785-789	5
α-helix	794-806	13
β-strand	810	1	2
α-helix	812-814	3
β-strand	848	1	4
α-helix	849-851	3
β-strand	854-856	3	5
β-strand	859-865	7	5
α-helix	868-876	9
α-helix	902-903	2
α-helix	905-924	20
α-helix	933-952	20
α-helix	964-987	24
β-strand	991-995	5	5
β-strand	996	1	4
β-strand	999-1006	8	5
α-helix	1009-1024	16
β-strand	1032-1045	14	5
β-strand	1048-1056	9	5
β-strand	1062-1069	8	5
α-helix	1080-1094	15
α-helix	1099-1118	20
α-helix	1124-1127	4
β-strand	1129-1132	4	6
α-helix	1147-1158	12
α-helix	1166	1
β-strand	1167-1170	4	6
β-strand	1171-1172	2	7
β-strand	1173	1	8
α-helix	1190-1192	3
β-strand	1193-1194	2	7
α-helix	1196-1199	4
α-helix	1202-1204	3
β-strand	1208	1	8
α-helix	1210-1212	3
α-helix	1213-1219	7
α-helix	1220-1225	6
α-helix	1234-1241	8
α-helix	1245-1253	9
α-helix	1267-1270	4
α-helix	1273-1278	6
β-strand	1283-1286	4	9
β-strand	1293-1296	4	9
β-strand	1305-1307	3	10
β-strand	1312-1314	3	10
α-helix	1319	1
β-strand	1320	1	10
α-helix	1321-1322	2
α-helix	1323-1342	20
β-strand	1346-1348	3	11
β-strand	1356-1357	2	11
β-strand	1366	1	12
α-helix	1374	1
β-strand	1375	1	12
β-strand	1376-1378	3	11
α-helix	1382-1395	14
α-helix	1398-1402	5
α-helix	1407-1408	2
α-helix	1421-1423	3
α-helix	1424-1433	10
α-helix	1435-1449	15

Chain A: 28 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	15-17	3
α-helix	18-22	5
α-helix	25-33	9
α-helix	40-43	4
β-strand	45-50	6	13
β-strand	57-60	4	13
α-helix	65-75	11
β-strand	79-86	8	13
α-helix	90-95	6
β-strand	103-105	3	13
β-strand	108-112	5	14
α-helix	115-120	6
α-helix	134-146	13
α-helix	147-151	5
β-strand	157-161	5	14
β-strand	167-171	5	14
α-helix	174-177	4
α-helix	181-191	11
α-helix	209-210	2
α-helix	211-224	14
α-helix	225-232	8
α-helix	234-236	3
α-helix	238-240	3
α-helix	241-245	5
α-helix	246-248	3
α-helix	252-261	10
α-helix	270-284	15
α-helix	290-309	20
β-strand	313	1	14
α-helix	315-319	5
β-strand	325-326	2	13
α-helix	327	1
α-helix	330	1
β-strand	331	1	15
α-helix	332	1
β-strand	337	1	16
β-strand	338	1	15
β-strand	341-342	2	14
α-helix	348-350	3
α-helix	352	1
β-strand	353	1	16
α-helix	376-393	18

Chain B: 30 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	44-54	11
α-helix	65-66	2
α-helix	72-94	23
α-helix	99-112	14
α-helix	121-137	17
α-helix	142-162	21
α-helix	165-173	9
β-strand	181-182	2	17
α-helix	183-184	2
α-helix	185-190	6
α-helix	192-206	15
α-helix	212-221	10
β-strand	225-228	4	17
α-helix	229-231	3
α-helix	233-238	6
β-strand	242-244	3	17
β-strand	247-249	3	17
α-helix	255-277	23
α-helix	280-283	4
α-helix	287-298	12
α-helix	327-330	4
α-helix	335-347	13
α-helix	352-364	13
α-helix	369-379	11
α-helix	388-394	7
α-helix	396-401	6
α-helix	412-415	4
α-helix	417-422	6
α-helix	424-426	3
α-helix	435-438	4
α-helix	441-449	9
α-helix	455-466	12
α-helix	470-481	12
α-helix	500-510	11

Chain C: 25 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	254-276	23
α-helix	280-282	3
β-strand	283	1	18
β-strand	294-302	9	18
β-strand	316-319	4	18
α-helix	322-325	4
β-strand	329-333	5	18
β-strand	340-342	3	19
β-strand	347-353	7	18
β-strand	360-366	7	18
α-helix	367-371	5
β-strand	372	1	20
α-helix	373-374	2
β-strand	375-377	3	21
α-helix	378-388	11
α-helix	392	1
β-strand	393-398	6	22
β-strand	399	1	23
α-helix	411-419	9
α-helix	420-424	5
β-strand	428-432	5	22
β-strand	437	1	24
α-helix	441-445	5
α-helix	448-450	3
α-helix	461-468	8
α-helix	470-474	5
β-strand	481-485	5	22
β-strand	490	1	24
β-strand	498	1	25
β-strand	500	1	26
α-helix	501-503	3
β-strand	515-517	3	22
β-strand	520	1	26
β-strand	522	1	27
β-strand	531-533	3	27
α-helix	538-541	4
β-strand	545-547	3	19
α-helix	549-553	5
α-helix	556-567	12
β-strand	569	1	28
α-helix	576-577	2
β-strand	578-579	2	29
β-strand	608-609	2	29
β-strand	612	1	25
α-helix	614-620	7
β-strand	621	1	28
α-helix	622	1
α-helix	623-625	3
β-strand	626	1	20
α-helix	627-628	2
β-strand	630-632	3	27
β-strand	640-644	5	27
β-strand	647-651	5	27
β-strand	654	1	23
β-strand	656	1	30
β-strand	662	1	30
β-strand	665-670	6	22
α-helix	671-673	3
β-strand	681-683	3	21
α-helix	684	1
β-strand	689-691	3	21
α-helix	694-697	4
β-strand	698-703	6	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA polymerase	1	protein	1468	Saccharomyces cerevisiae	P13382 (AlphaFold model)
DNA primase	A	protein	409	Saccharomyces cerevisiae	P10363 (AlphaFold model)
DNA primase large subunit	B	protein	528	Saccharomyces cerevisiae	P20457 (AlphaFold model)
DNA polymerase alpha subunit B	C	protein	705	Saccharomyces cerevisiae	P38121 (AlphaFold model)
template DNA	T	DNA	21	synthetic construct
RNA-DNA chimeric primer	P	RNA	14	synthetic construct

Sequence of entity 1 (1), FASTA

>8FOK_1 DNA polymerase (chains 1)
MSSKSEKLEKLRKLQAARNGTSIDDYEGDESDGDRIYDEIDEKEYRARKRQELLHDDFVV
DDDGVGYVDRGVEEDWREVDNSSSDEDTGNLASKDSKRKKNIKREKDHQITDMLRTQHSK
STLLAHAKKSQKKSIPIDNFDDILGEFESGEVEKPNILLPSKLRENLNSSPTSEFKSSIK
RVNGNDESSHDAGISKKVKIDPDSSTDKYLEIESSPLKLQSRKLRYANDVQDLLDDVENS
PVVATKRQNVLQDTLLANPPSAQSLADEEDDEDSDEDIILKRRTMRSVTTTRRVNIDSRS
NPSTSPFVTAPGTPIGIKGLTPSKSLQSNTDVATLAVNVKKEDVVDPETDTFQMFWLDYC
EVNNTLILFGKVKLKDDNCVSAMVQINGLCRELFFLPREGKTPTDIHEEIIPLLMDKYGL
DNIRAKPQKMKYSFELPDIPSESDYLKVLLPYQTPKSSRDTIPSDLSSDTFYHVFGGNSN
IFESFVIQNRIMGPCWLDIKGADFNSIRNASHCAVEVSVDKPQNITPTTTKTMPNLRCLS
LSIQTLMNPKENKQEIVSITLSAYRNISLDSPIPENIKPDDLCTLVRPPQSTSFPLGLAA
LAKQKLPGRVRLFNNEKAMLSCFCAMLKVEDPDVIIGHRLQNVYLDVLAHRMHDLNIPTF
SSIGRRLRRTWPEKFGRGNSNMNHFFISDICSGRLICDIANEMGQSLTPKCQSWDLSEMY
QVTCEKEHKPLDIDYQNPQYQNDVNSMTMALQENITNCMISAEVSYRIQLLTLTKQLTNL
AGNAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEGNRSRAQKQRQNEENADAPVNSKK
AKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEFNICFTTVDRNKEDIDELPSVPPSE
VDQGVLPRLLANLVDRRREVKKVMKTETDPHKRVQCDIRQQALKLTANSMYGCLGYVNSR
FYAKPLAMLVTNKGREILMNTRQLAESMNLLVVYGDTDSVMIDTGCDNYADAIKIGLGFK
RLVNERYRLLEIDIDNVFKKLLLHAKKKYAALTVNLDKNGNGTTVLEVKGLDMKRREFCP
LSRDVSIHVLNTILSDKDPEEALQEVYDYLEDIRIKVETNNIRIDKYKINMKLSKDPKAY
PGGKNMPAVQVALRMRKAGRVVKAGSVITFVITKQDEIDNAADTPALSVAERAHALNEVM
IKSNNLIPDPQYYLEKQIFAPVERLLERIDSFNVVRLSEALGLDSKKYFRREGGNNNGED
INNLQPLETTITDVERFKDTVTLELSCPSCDKRFPFGGIVSSNYYRVSYNGLQCKHCEQL
FTPLQLTSQIEHSIRAHISLYYAGWLQCDDSTCGIVTRQVSVFGKRCLNDGCTGVMRYKY
SDKQLYNQLLYFDSLFDCEKNKKQELKPIYLPDDLDYPKEQLTESSIKALTEQNRELMET
GRSVVQKYLNDCGRRYVDMTSIFDFMLN

Sequence of entity 2 (A), FASTA

>8FOK_2 DNA primase (chains A)
MTNSVKTNGPSSSDMEYYYKSLYPFKHIFNWLNHSPKPSRDMINREFAMAFRSGAYKRYN
SFNSVQDFKAQIEKANPDRFEIGAIYNKPPRERDTLLKSELKALEKELVFDIDMDDYDAF
RTCCSGAQVCSKCWKFISLAMKITNTALREDFGYKDFIWVFSGRRGAHCWVSDKRARALT
DVQRRNVLDYVNVIRDRNTDKRLALKRPYHPHLARSLEQLKPFFVSIMLEEQNPWEDDQH
AIQTLLPALYDKQLIDSLKKYWLDNPRRSSKEKWNDIDQIATSLFKGPKQDSHIIKLREC
KEDLVLMTLYPKLDVEVTKQTIHLLKAPFCIHPATGNVCVPIDESFAPEKAPKLIDLQTE
MEKNNDVSLTALQPFINQFQAYVSSLLKNELGSVKREREDDDEPASLDF

Sequence of entity 3 (B), FASTA

>8FOK_3 DNA primase large subunit (chains B)
MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILSSSSSEEEKKLYARLYESKLS
FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES
LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL
QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL
VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI
ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL
FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI
LSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFEM
THNSASADLEIGEQTHIAHPNLYFERSRQLQKKQQKLEKEKLFNNGNH

Sequence of entity 4 (C), FASTA

>8FOK_4 DNA polymerase alpha subunit B (chains C)
MSGSIDVITHFGPDADKPEIITALENLTKLHALSVEDLYIKWEQFSNQRRQTHTDLTSKN
IDEFKQFLQLQMEKRANQISSSSKVNTSTKKPVIKKSLNSSPLFGLSIPKTPTLKKRKLH
GPFSLSDSKQTYNVGSEAETNEKGNSSLKLEFTPGMAEDAVGDSAPLSHAKSSDAKTPGS
STFQTPTTNTPTTSRQNVPAGEILDSLNPENIEISSGNPNVGLLSTEEPSYNQVKVEPFY
DAKKYKFRTMRQNLQEASDVLDDQIESFTKIIQNHYKLSPNDFADPTIQSQSEIYAVGRI
VPDSPTYDKFLNPESLSLETSRMGGVGRRVRLDLSQVNELSFFLGQIVAFKGKNANGDYF
TVNSILPLPYPNSPVSTSQELQEFQANLEGSSLKVIVTCGPYFANDNFSLELLQEFIDSI
NNEVKPHVLIMFGPFIDITHPLIASGKLPNFPQFKTQPKTLDELFLKLFTPILKTISPHI
QTVLIPSTKDAISNHAAYPQASLIRKALQLPKRNFKCMANPSSFQINEIYFGCSNVDTFK
DLKEVIKGGTTSSRYRLDRVSEHILQQRRYYPIFPGSIRTRIKPKDVSTKKETNDMESKE
EKVYEHISGADLDVSYLGLTEFVGGFSPDIMIIPSELQHFARVVQNVVVINPGRFIRATG
NRGSYAQITVQCPDLEDGKLTLVEGEEPVYLHNVWKRARVDLIAS

Sequence of entity 5 (T), FASTA

>8FOK_5 template DNA (chains T)
TGTCCCCTCGCTGCCGCCGCC

Sequence of entity 6 (P), FASTA

>8FOK_6 RNA-DNA chimeric primer (chains P)
AGGCGGGCAGCGAA

Ligands and cofactors

ID	Name	Formula	Copies
SF4	Iron/sulfur cluster	Fe4 S4	1

Primary citation

Molecular choreography of primer synthesis by the eukaryotic Pol alpha-primase. Yuan, Z., Georgescu, R., Li, H. et al. Nat Commun (2023) 14:3697-3697. DOI 10.1038/s41467-023-39441-1 · PubMed

Other PDB entries of the same protein (UniProt P13382 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FVM 2.3 Å, Crystal structure of yeast DNA polymerase alpha
3OIQ 2.4 Å, Crystal structure of yeast telomere protein Cdc13 OB1 and the catalytic subunit of DNA…
3FLO 2.5 Å, Crystal structure of the carboxyl-terminal domain of yeast DNA polymerase alpha in…
4B08 2.67 Å, Yeast DNA polymerase alpha, Selenomethionine protein
4C93 2.69 Å, Crystal structure of the carboxy-terminal domain of yeast Ctf4 bound to Pol alpha.
4FXD 3.0 Å, Crystal structure of yeast DNA polymerase alpha bound to DNA/RNA
4FYD 3.1 Å, Crystal structure of yeast DNA polymerase alpha bound to DNA/RNA and dGTP
8B9A 3.5 Å, S. cerevisiae replisome + Ctf4, bound by pol alpha primase. Complex engaged with a fork…
8B9B 3.5 Å, S. cerevisiae replisome + Ctf4, bound by pol alpha. Complex engaged with a fork DNA…
8FOC 3.7 Å, Cryo-EM structure of S. cerevisiae DNA polymerase alpha-primase in Apo state…
8FOD 3.8 Å, Cryo-EM structure of S. cerevisiae DNA polymerase alpha-primase complex in Apo state…
8B9C 4.6 Å, S. cerevisiae pol alpha - replisome complex

Browse structure collections

About this viewer

MolViewer shows 8FOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.