4LIR: Nucleoporin 35kDa (NUP35) from Homo sapiens

Crystal structure of a nucleoporin 35kDa (NUP35) from Homo sapiens at 2.46 A resolution. Determined by X-ray diffraction at 2.46 Å resolution. Released 11 Sept 2013.

Method: X-ray diffraction
Resolution: 2.46 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,286
Mol. weight: 26.27 kDa
Released: 11 Sept 2013

Explore 4LIR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LIR contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	172-174	3
β-strand	175-179	5	1
α-helix	183-185	3
α-helix	186-193	8
β-strand	199-204	6	1
β-strand	210-215	6	1
α-helix	218-225	8
β-strand	230-232	3	2
β-strand	236-238	3	2
β-strand	239-242	4	1
α-helix	246-249	4

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	170-174	5
β-strand	175-179	5	3
α-helix	183-185	3
α-helix	186-193	8
β-strand	199-204	6	3
β-strand	210-215	6	3
α-helix	218-225	8
β-strand	231-232	2	4
β-strand	236-237	2	4
β-strand	239-242	4	3
α-helix	246-251	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin NUP53	A, B	protein	117	Homo sapiens	Q8NFH5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4LIR_1 Nucleoporin NUP53 (chains A, B)
GSPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGN
WMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMESSDRCALSSPSLAFTP

Primary citation

Crystal structure of a nucleoporin 35kDa (NUP35) from Homo sapiens at 2.46 A resolution. Joint Center for Structural Genomics (JCSG), Partnership for T-Cell Biology (TCELL). To be published.

Other PDB entries of the same protein (UniProt Q8NFH5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OZB 2.09 Å, Crystal structure of Nup35-Nb complex
7MW1 3.4 Å, Crystal structure of the Homo sapiens NUP93-NUP53 complex (NUP93 residues 174-819; NUP53…
7R5K 12.0 Å, Human nuclear pore complex (constricted)
7R5J 50.0 Å, Human nuclear pore complex (dilated)

Browse structure collections

About this viewer

MolViewer shows 4LIR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.