Crystal structure of the Homo sapiens NUP93-NUP53 complex (NUP93 residues 174-819; NUP53 residues 84-150). Determined by X-ray diffraction at 3.4 Å resolution. Released 15 Jun 2022.
Explore 7MW1 in 3D Show helices and sheets RCSB PDB PDBe
7MW1 contains 84 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 180-197 | 18 | |
| α-helix | 205-213 | 9 | |
| α-helix | 218-231 | 14 | |
| α-helix | 241-246 | 6 | |
| α-helix | 248-274 | 27 | |
| α-helix | 278-284 | 7 | |
| α-helix | 286-288 | 3 | |
| α-helix | 289-300 | 12 | |
| α-helix | 304-305 | 2 | |
| β-strand | 312-313 | 2 | 1 |
| β-strand | 316-317 | 2 | 1 |
| α-helix | 318-328 | 11 | |
| α-helix | 331-339 | 9 | |
| α-helix | 342-345 | 4 | |
| α-helix | 348-357 | 10 | |
| α-helix | 359-361 | 3 | |
| α-helix | 365-378 | 14 | |
| α-helix | 385-394 | 10 | |
| α-helix | 410-418 | 9 | |
| β-strand | 421-422 | 2 | 2 |
| β-strand | 435-436 | 2 | 2 |
| α-helix | 437-447 | 11 | |
| α-helix | 450-453 | 4 | |
| α-helix | 459-467 | 9 | |
| α-helix | 472-481 | 10 | |
| α-helix | 486-497 | 12 | |
| β-strand | 504 | 1 | 3 |
| β-strand | 513-514 | 2 | 3 |
| β-strand | 525-526 | 2 | 3 |
| α-helix | 528-539 | 12 | |
| α-helix | 544-551 | 8 | |
| α-helix | 552-554 | 3 | |
| β-strand | 558 | 1 | 4 |
| β-strand | 564 | 1 | 4 |
| α-helix | 565-577 | 13 | |
| α-helix | 580 | 1 | |
| α-helix | 581-585 | 5 | |
| β-strand | 587 | 1 | 5 |
| β-strand | 593 | 1 | 5 |
| α-helix | 597-600 | 4 | |
| α-helix | 606-618 | 13 | |
| α-helix | 622-631 | 10 | |
| α-helix | 635-646 | 12 | |
| α-helix | 647-649 | 3 | |
| α-helix | 659-676 | 18 | |
| α-helix | 683-702 | 20 | |
| α-helix | 707-717 | 11 | |
| α-helix | 724-726 | 3 | |
| α-helix | 727-735 | 9 | |
| α-helix | 739-742 | 4 | |
| α-helix | 745-761 | 17 | |
| α-helix | 781-798 | 18 | |
| α-helix | 804-818 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 180-197 | 18 | |
| α-helix | 205-213 | 9 | |
| α-helix | 218-231 | 14 | |
| α-helix | 241-246 | 6 | |
| α-helix | 248-274 | 27 | |
| α-helix | 278-284 | 7 | |
| α-helix | 286-288 | 3 | |
| α-helix | 289-300 | 12 | |
| α-helix | 304-305 | 2 | |
| β-strand | 312-313 | 2 | 6 |
| β-strand | 316-317 | 2 | 6 |
| α-helix | 318-328 | 11 | |
| α-helix | 331-339 | 9 | |
| α-helix | 348-357 | 10 | |
| α-helix | 359-361 | 3 | |
| α-helix | 365-378 | 14 | |
| α-helix | 385-394 | 10 | |
| β-strand | 409 | 1 | 7 |
| α-helix | 410-418 | 9 | |
| β-strand | 421-422 | 2 | 8 |
| β-strand | 435-436 | 2 | 8 |
| α-helix | 437-442 | 6 | |
| α-helix | 443-447 | 5 | |
| α-helix | 450-454 | 5 | |
| α-helix | 459-467 | 9 | |
| α-helix | 472-481 | 10 | |
| α-helix | 486-498 | 13 | |
| β-strand | 504 | 1 | 9 |
| β-strand | 513-514 | 2 | 9 |
| β-strand | 525-526 | 2 | 9 |
| α-helix | 528-539 | 12 | |
| α-helix | 544-551 | 8 | |
| α-helix | 552-556 | 5 | |
| β-strand | 558 | 1 | 10 |
| β-strand | 564 | 1 | 10 |
| α-helix | 565-577 | 13 | |
| α-helix | 580 | 1 | |
| α-helix | 581-585 | 5 | |
| β-strand | 587 | 1 | 11 |
| β-strand | 593 | 1 | 11 |
| α-helix | 597-601 | 5 | |
| α-helix | 606-618 | 13 | |
| α-helix | 622-631 | 10 | |
| α-helix | 635-646 | 12 | |
| α-helix | 647-649 | 3 | |
| α-helix | 659-675 | 17 | |
| α-helix | 683-702 | 20 | |
| α-helix | 707-717 | 11 | |
| α-helix | 724-726 | 3 | |
| α-helix | 727-734 | 8 | |
| α-helix | 739-742 | 4 | |
| α-helix | 745-761 | 17 | |
| α-helix | 781-798 | 18 | |
| α-helix | 804-818 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 92 | 1 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear pore complex protein Nup93 | A, B | protein | 672 | Homo sapiens | Q8N1F7 (AlphaFold model) |
| Nucleoporin Nup35 | C, D | protein | 68 | Homo sapiens | Q8NFH5 (AlphaFold model) |
>7MW1_1 Nuclear pore complex protein Nup93 (chains A, B) SSGLNDIFEAQKIEWHEGSAGGSGGSGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVD LCASVAELDDKSISDMWTMVKQMTDVLLTPATDALKNRSSVEVRMEFVRQALAYLEQSYK NYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIKLPAPLPGLQDGEVEGHPVWALIYYCMR CGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKDRRLSPATENKLRLHYRRALRNNTDPYK RAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLED YGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLFRMERLRCHAVHVALVLFELKLLLKSSG QSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDSQGENMFL RCVSELVIESREFDMILGKLENDGSRKPGVIDKFTSDTKPIINKVASVAENKGLFEEAAK LYDLAKNADKVLELMNKLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANKFVDS TFYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSE VLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDT NARLVQMEVLMN
>7MW1_2 Nucleoporin Nup35 (chains C, D) SDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASI GQPRKTTL
Architecture of the linker-scaffold in the nuclear pore. Petrovic, S., Samanta, D., Perriches, T. et al. Science (2022) 376:eabm9798-eabm9798. DOI 10.1126/science.abm9798 · PubMed
Other PDB entries of the same protein (UniProt Q8N1F7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7MW1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.