4LLD: Ig gamma-1 chain C region

Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain lambda constant domain (IgG1 CH1:Clambda) at 1.19A. Determined by X-ray diffraction at 1.19 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 1.19 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,846
Mol. weight: 25.32 kDa
Released: 29 Jan 2014

Explore 4LLD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LLD contains 11 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	136	1	1
α-helix	137-138	2
β-strand	139-146	8	2
β-strand	154-164	11	2
β-strand	165	1	1
β-strand	170-173	4	3
α-helix	174-176	3
β-strand	178	1	3
β-strand	182-184	3	2
α-helix	185-187	3
β-strand	188-189	2	2
α-helix	190	1
β-strand	195-204	10	2
α-helix	205-207	3
β-strand	214-219	6	3
α-helix	220-222	3
β-strand	224-229	6	3

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	115	1	4
α-helix	116-117	2
β-strand	118-122	5	5
α-helix	123-125	3
α-helix	126-130	5
β-strand	134-143	10	5
β-strand	144	1	4
β-strand	149-154	6	6
β-strand	157-159	3	6
β-strand	163-165	3	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-184	9	5
α-helix	186-191	6
β-strand	195-201	7	6
β-strand	204-210	7	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig gamma-1 chain C region	A	protein	111	Homo sapiens	P01857 (AlphaFold model)
Ig lambda-2 chain C region	B	protein	129	Homo sapiens	P0DOY2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LLD_1 Ig gamma-1 chain C region (chains A)
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSHHHHHH

Sequence of entity 2 (B), FASTA

>4LLD_2 Ig lambda-2 chain C region (chains B)
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSK
QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECLESGKETAAAKFERQ
HMDSSTSAA

Primary citation

Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface. Lewis, S.M., Wu, X., Pustilnik, A. et al. Nat Biotechnol (2014) 32:191-198. DOI 10.1038/nbt.2797 · PubMed

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
5HSF 1.52 Å, 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
3MCL 1.7 Å, Anti-beta-amyloid antibody c706 fab in space group P21
5U66 1.7 Å, Modified single helix from the B-domain of protein A bound to IgG1 Fc
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement
3DJ9 1.75 Å, Crystal Structure of an isolated, unglycosylated antibody CH2 domain

Browse structure collections

About this viewer

MolViewer shows 4LLD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.