4LLI: Human Myosin 5a globular domain

Crystal Structure of human Myosin 5a globular domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,441
Mol. weight: 90.33 kDa
Released: 25 Dec 2013

Explore 4LLI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LLI contains 52 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1468-1471	4
β-strand	1477-1478	2	1
α-helix	1481-1483	3
α-helix	1484-1488	5
α-helix	1489-1493	5
α-helix	1501-1504	4
α-helix	1508-1522	15
α-helix	1526-1547	22
α-helix	1551-1570	20
α-helix	1575-1577	3
α-helix	1583-1587	5
α-helix	1596-1626	31
α-helix	1627-1631	5
α-helix	1661-1677	17
α-helix	1682-1706	25
α-helix	1708-1710	3
α-helix	1713-1732	20
α-helix	1742-1744	3
α-helix	1745-1755	11
α-helix	1761-1770	10
α-helix	1776-1785	10
α-helix	1786-1788	3
α-helix	1795-1797	3
α-helix	1798-1808	11
α-helix	1825-1827	3
α-helix	1838-1840	3
α-helix	1845-1847	3
β-strand	1853-1854	2	1

Chain B: 26 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1468-1471	4
β-strand	1477-1478	2	2
α-helix	1481-1483	3
α-helix	1484-1488	5
α-helix	1489-1493	5
α-helix	1501-1504	4
α-helix	1508-1522	15
α-helix	1526-1547	22
α-helix	1551-1570	20
α-helix	1575-1577	3
α-helix	1583-1587	5
α-helix	1596-1626	31
α-helix	1627-1631	5
α-helix	1661-1677	17
α-helix	1682-1705	24
α-helix	1708-1710	3
α-helix	1713-1732	20
α-helix	1741-1744	4
α-helix	1745-1755	11
α-helix	1761-1770	10
α-helix	1776-1785	10
α-helix	1795-1797	3
α-helix	1798-1807	10
α-helix	1808-1810	3
α-helix	1825-1827	3
α-helix	1838-1840	3
α-helix	1845-1847	3
β-strand	1853-1854	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-Va	A, B	protein	395	Homo sapiens	Q9Y4I1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4LLI_1 Unconventional myosin-Va (chains A, B)
GPLGSMPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVRHA
DYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKH
NTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGVSG
VKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAIT
LNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKT
DDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMD
AKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV

Primary citation

Structural insights into the globular tails of the human type v myosins myo5a, myo5b, and myo5c. Velvarska, H., Niessing, D. PLoS One (2013) 8:e82065-e82065. DOI 10.1371/journal.pone.0082065 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4I1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LX2 1.5 Å, Crystal structure of Myo5a globular tail domain in complex with melanophilin GTBD
5JCY 1.8 Å, Spir2-GTBM bound to MyoVa-GTD
4D07 1.85 Å, DYNLL2 dynein light chain binds to an extended, unstructured linear motif of myosin 5a…
4LX1 1.87 Å, Crystal structure of Myo5a globular tail domain
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
4J5L 2.2 Å, Structure of the Cargo Binding Domain from Human Myosin Va

Browse structure collections

About this viewer

MolViewer shows 4LLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.