4LSZ: Caspase-7

Caspase-7 in Complex with DARPin D7.18. Determined by X-ray diffraction at 2.26 Å resolution. Released 2 Jul 2014.

Method: X-ray diffraction
Resolution: 2.26 Å
Organisms: Homo sapiens, synthetic construct
Chains: 6
Atoms: 6,245
Mol. weight: 100.94 kDa
Released: 2 Jul 2014

Explore 4LSZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LSZ contains 40 α-helices and 38 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	59	1	1
β-strand	66-74	9	2
α-helix	80-82	3
α-helix	84-86	3
α-helix	90-104	15
β-strand	106-112	7	2
α-helix	116-127	12
β-strand	134-142	9	2
β-strand	145-146	2	3
β-strand	149-152	4	3
β-strand	155-158	4	3
α-helix	159-163	5
α-helix	164-166	3
α-helix	172-174	3
β-strand	179-184	6	2
β-strand	190	1	4
β-strand	192	1	5
β-strand	195-196	2	6

Chains B and D: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	212-213	2	7
β-strand	219-223	5	2
β-strand	229	1	4
β-strand	233-234	2	8
β-strand	238-239	2	8
α-helix	240-252	13
α-helix	258-272	15
α-helix	280-282	3
β-strand	286	1	5
β-strand	290-293	4	2
β-strand	298	1	1

Chain C: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	59	1	9
β-strand	66-74	9	2
α-helix	80-82	3
α-helix	90-104	15
β-strand	107-112	6	2
α-helix	116-127	12
β-strand	134-142	9	2
β-strand	145-146	2	10
β-strand	149-151	3	10
β-strand	156-158	3	10
α-helix	159-163	5
α-helix	164-166	3
α-helix	172-174	3
β-strand	179-184	6	2
β-strand	190	1	11
β-strand	192	1	12
β-strand	195-196	2	7

Chain E: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	13-24	12
α-helix	27-35	9
α-helix	50-56	7
α-helix	60-68	9
α-helix	83-90	8
α-helix	93-101	9
α-helix	116-122	7
α-helix	126-134	9
α-helix	149-155	7
α-helix	159-163	5

Chain F: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	14-24	11
α-helix	27-35	9
α-helix	50-56	7
α-helix	60-68	9
α-helix	83-90	8
α-helix	93-101	9
α-helix	116-122	7
α-helix	126-134	9
α-helix	141-143	3
α-helix	149-155	7
α-helix	159-165	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-7 subunit p20	A, C	protein	175	Homo sapiens	P55210 (AlphaFold model)
Caspase-7 subunit p10	B, D	protein	105	Homo sapiens	P55210 (AlphaFold model)
DARPin D7.18	E, F	protein	169	synthetic construct

Sequence of entity 1 (A, C), FASTA

>4LSZ_1 Caspase-7 subunit p20 (chains A, C)
AKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTG
MGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLS
HGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQAD

Sequence of entity 2 (B, D), FASTA

>4LSZ_2 Caspase-7 subunit p10 (chains B, D)
ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVN
DRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQLEHHHHHH

Sequence of entity 3 (E, F), FASTA

>4LSZ_3 DARPin D7.18 (chains E, F)
MRGSHHHHHHGSDLGKKLLEAARAGQDDEVRILMANGADVNADDAWGQTPLHLAAQNGHL
EIVEVLLKHDADVNATDWVGMTPLHLAADDGHLEIVEALLKYGADVNAYDQLGNTPLNLA
ATDGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN

Primary citation

Combined inhibition of caspase 3 and caspase 7 by two highly selective DARPins slows down cellular demise. Flutsch, A., Ackermann, R., Schroeder, T. et al. Biochem J (2014) 461:279-290. DOI 10.1042/BJ20131456 · PubMed

Other PDB entries of the same protein (UniProt P55210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JR2 1.65 Å, Human procaspase-7/caspase-7 heterodimer bound to Ac-DEVD-CMK
4JB8 1.7 Å, Caspase-7 in Complex with DARPin C7_16
2QL9 2.14 Å, Crystal Structure of Caspase-7 with inhibitor AC-DQMD-CHO
4JR1 2.15 Å, Human procaspase-7 bound to Ac-DEVD-CMK
5K20 2.2 Å, Caspase-7 S239E Phosphomimetic
2QLB 2.25 Å, Crystal Structure of caspase-7 with inhibitor AC-ESMD-CHO
4ZVR 2.3 Å, Caspase-7 Variant 4 (V4) with reprogrammed substrate specificity due to…
2QL5 2.34 Å, Crystal Structure of caspase-7 with inhibitor AC-DMQD-CHO
1F1J 2.35 Å, Crystal structure of caspase-7 in complex with acetyl-asp-glu-val-asp-cho
6CL2 2.35 Å, Caspase-7 in complex with Ac-ATS009-KE
1I4O 2.4 Å, Crystal structure of the xiap/caspase-7 complex
2QL7 2.4 Å, Crystal Structure of Caspase-7 with inhibitor AC-IEPD-CHO

Browse structure collections

About this viewer

MolViewer shows 4LSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.