4LTB: Coiled-coil domain of TRIM25

Coiled-coil domain of TRIM25. Determined by X-ray diffraction at 2.59 Å resolution. Released 5 Feb 2014.

Method: X-ray diffraction
Resolution: 2.59 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,833
Mol. weight: 43.74 kDa
Released: 5 Feb 2014

Explore 4LTB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LTB contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	191-300	110
α-helix	307-316	10
α-helix	331-358	28

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	191-300	110
α-helix	307-315	9
α-helix	331-358	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tripartite motif-containing 25 variant	A, B	protein	191	Homo sapiens	Q14258 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4LTB_1 Tripartite motif-containing 25 variant (chains A, B)
ASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEM
KALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLTKRDEFEFL
EKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQELTPSSGDPGEH
DPASTHKSTRP

Primary citation

The tripartite motif coiled-coil is an elongated antiparallel hairpin dimer. Sanchez, J.G., Okreglicka, K., Chandrasekaran, V. et al. Proc Natl Acad Sci U S A (2014) 111:2494-2499. DOI 10.1073/pnas.1318962111 · PubMed

Other PDB entries of the same protein (UniProt Q14258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9I0T 1.8 Å, Crystal structure of TRIM25 PRYSPRY covalently bound to…
6FLM 2.01 Å, Crystal structure of the human TRIM25 PRYSPRY domain
5FER 2.34 Å, Complex of TRIM25 RING with UbcH5-Ub
5EYA 2.4 Å, TRIM25 RING domain in complex with Ubc13-Ub conjugate
9IUN 2.7 Å, Crystal structure of Trim25 Pspry
4CFG 2.8 Å, Structure of the TRIM25 coiled-coil
5NT1 2.82 Å, Complex of influenza A NS1 effector domain with TRIM25 coiled coil
6FLN 3.6 Å, Crystal structure of the human TRIM25 coiled-coil and PRYSPRY domains
5NT2 4.26 Å, Complex of influenza A NS1 with TRIM25 coiled coil domain

Browse structure collections

About this viewer

MolViewer shows 4LTB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.