6FLM: Human TRIM25 PRYSPRY domain

Crystal structure of the human TRIM25 PRYSPRY domain. Determined by X-ray diffraction at 2.01 Å resolution. Released 23 May 2018.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,422
Mol. weight: 69.37 kDa
Released: 23 May 2018

Explore 6FLM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FLM contains 14 α-helices and 51 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	433-445	13
α-helix	449-453	5
β-strand	456	1	1
β-strand	461	1	2
β-strand	470-473	4	1
β-strand	478-481	4	1
α-helix	488-490	3
β-strand	500-502	3	3
β-strand	503	1	2
β-strand	507	1	3
β-strand	511-519	9	1
β-strand	523-530	8	3
α-helix	538-540	3
β-strand	548-554	7	3
β-strand	557-562	6	3
β-strand	565-568	4	3
β-strand	576-582	7	1
β-strand	587-593	7	1
β-strand	597-604	8	1
β-strand	611-617	7	3
β-strand	623-626	4	1

Chain B: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	434-445	12
α-helix	449-452	4
α-helix	453-455	3
β-strand	456	1	4
β-strand	461	1	5
β-strand	470-473	4	4
β-strand	478-481	4	4
α-helix	488-490	3
β-strand	500-502	3	6
β-strand	503	1	5
β-strand	507	1	6
β-strand	511-518	8	4
β-strand	523-530	8	6
α-helix	538-540	3
β-strand	548-554	7	6
β-strand	557-562	6	6
β-strand	565-568	4	6
β-strand	576-582	7	4
β-strand	587-593	7	4
β-strand	597-604	8	4
β-strand	611-617	7	6
β-strand	623-626	4	4

Chain C: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	433-445	13
α-helix	449-452	4
α-helix	453-455	3
β-strand	456	1	7
β-strand	461	1	8
β-strand	470-472	3	7
β-strand	478-481	4	7
α-helix	488-490	3
β-strand	500-502	3	9
β-strand	503	1	8
β-strand	507	1	9
β-strand	511-518	8	7
β-strand	524-530	7	9
α-helix	538-540	3
β-strand	548-554	7	9
β-strand	557-562	6	9
β-strand	565-568	4	9
β-strand	576-582	7	7
β-strand	587-593	7	7
β-strand	597-604	8	7
β-strand	611-617	7	9
β-strand	623-626	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin/ISG15 ligase TRIM25	A, B, C	protein	199	Homo sapiens	Q14258 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6FLM_1 E3 ubiquitin/ISG15 ligase TRIM25 (chains A, B, C)
GMASLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRPH
PQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWCV
EWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLMYKFRVDFTEAL
YPAFWVFSAGATLSICSPK

Primary citation

Molecular mechanism of influenza A NS1-mediated TRIM25 recognition and inhibition. Koliopoulos, M.G., Lethier, M., van der Veen, A.G. et al. Nat Commun (2018) 9:1820-1820. DOI 10.1038/s41467-018-04214-8 · PubMed

Other PDB entries of the same protein (UniProt Q14258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9I0T 1.8 Å, Crystal structure of TRIM25 PRYSPRY covalently bound to…
5FER 2.34 Å, Complex of TRIM25 RING with UbcH5-Ub
5EYA 2.4 Å, TRIM25 RING domain in complex with Ubc13-Ub conjugate
4LTB 2.59 Å, Coiled-coil domain of TRIM25
9IUN 2.7 Å, Crystal structure of Trim25 Pspry
4CFG 2.8 Å, Structure of the TRIM25 coiled-coil
5NT1 2.82 Å, Complex of influenza A NS1 effector domain with TRIM25 coiled coil
6FLN 3.6 Å, Crystal structure of the human TRIM25 coiled-coil and PRYSPRY domains
5NT2 4.26 Å, Complex of influenza A NS1 with TRIM25 coiled coil domain

Browse structure collections

About this viewer

MolViewer shows 6FLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.