4M6W: C-terminal segment of FANCM

Crystal structure of the C-terminal segment of FANCM in complex with FAAP24. Determined by X-ray diffraction at 2.9 Å resolution. Released 2 Oct 2013.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,081
Mol. weight: 48.82 kDa
Released: 2 Oct 2013

Explore 4M6W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4M6W contains 25 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1819-1823	5	1
α-helix	1826-1829	4
α-helix	1831-1839	9
β-strand	1844-1848	5	1
β-strand	1855-1856	2	1
β-strand	1861-1867	7	1
α-helix	1868-1872	5
α-helix	1877-1890	14
β-strand	1893-1899	7	1
α-helix	1900-1901	2
α-helix	1919-1927	9
β-strand	1931-1935	5	1
α-helix	1938-1954	17
α-helix	1973-1977	5
α-helix	1984-1991	8
α-helix	1997-2001	5
α-helix	2005-2011	7
α-helix	2018-2026	9

Chain B: 13 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	19-22	4	2
α-helix	23-25	3
α-helix	29-34	6
β-strand	40-43	4	2
β-strand	50-53	4	2
β-strand	56-61	6	2
α-helix	73-81	9
β-strand	86-92	7	2
α-helix	98-100	3
α-helix	101-105	5
α-helix	106-112	7
β-strand	115-119	5	2
α-helix	122-137	16
α-helix	139	1
α-helix	156-163	8
α-helix	173-180	8
α-helix	184-188	5
α-helix	192-198	7
α-helix	201-211	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fanconi anemia group M protein	A	protein	221	Homo sapiens	Q8IYD8 (AlphaFold model)
Fanconi anemia-associated protein of 24 kDa	B	protein	208	Homo sapiens	Q9BTP7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4M6W_1 Fanconi anemia group M protein (chains A)
MGQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSE
MLNSVNKNKFIEQIQHLQSMFERICVIVEKDREKTGDTSRMFRRTKSYDSLLTTLIGAGI
RILFSSCQEETADLLKELSLVEQRKNVGIHVPTVVNSNKSEALQFYLSIPNISYITALNM
CHQFSSVKRMANSSLQEISMYAQVTHQKAEEIYRYIHYVFD

Sequence of entity 2 (B), FASTA

>4M6W_2 Fanconi anemia-associated protein of 24 kDa (chains B)
MGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKR
LVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQE
QTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGEL
EQVVGQAVAQQIHAFFTQPRLEHHHHHH

Primary citation

Structural insights into the functions of the FANCM-FAAP24 complex in DNA repair. Yang, H., Zhang, T., Tao, Y. et al. Nucleic Acids Res (2013) 41:10573-10583. DOI 10.1093/nar/gkt788 · PubMed

Other PDB entries of the same protein (UniProt Q8IYD8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4E45 2.0 Å, Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi…
4BXO 2.15 Å, Architecture and DNA recognition elements of the Fanconi anemia FANCM- FAAP24 complex
9EL5 2.2 Å, FANCM translocase domain bound to DNA
9HJO 2.4 Å, FANCM-FAAP24-dsDNA complex
4DRB 2.63 Å, The crystal structure of FANCM bound MHF complex
4DAY 3.3 Å, Crystal structure of the RMI core complex with MM2 peptide from FANCM

Browse structure collections

About this viewer

MolViewer shows 4M6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.