4MHC: Nucleoporin

Crystal Structure of a Nucleoporin. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Sept 2013.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 5,447
Mol. weight: 91.57 kDa
Released: 25 Sept 2013

Explore 4MHC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MHC contains 32 α-helices and 38 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	90-106	17
α-helix	108-110	3
α-helix	114-116	3
β-strand	122-126	5	1
α-helix	133-135	3
β-strand	138-145	8	2
α-helix	146-147	2
α-helix	148-151	4
β-strand	161-166	6	3
β-strand	171-176	6	3
β-strand	179-184	6	3
β-strand	191-194	4	3
β-strand	201-207	7	4
α-helix	208-210	3
β-strand	220-226	7	4
β-strand	229-237	9	4
α-helix	243	1
β-strand	244-254	11	4
β-strand	260-266	7	5
β-strand	271-276	6	5
β-strand	284-286	3	5
β-strand	303-305	3	5
β-strand	342-348	7	6
β-strand	353-358	6	6
β-strand	363-369	7	6
β-strand	372-379	8	6
α-helix	381-391	11
α-helix	397-399	3
β-strand	406-411	6	7
β-strand	420-426	7	7
β-strand	431-435	5	7
β-strand	438-439	2	8
β-strand	442-443	2	8
α-helix	444-446	3
β-strand	447-452	6	7
α-helix	453-455	3
α-helix	483-486	4
β-strand	495	1	1
β-strand	500-502	3	1
β-strand	506-512	7	1
β-strand	536-543	8	1
α-helix	545-551	7
β-strand	555-560	6	1
α-helix	566	1
β-strand	567-572	6	2
α-helix	589-592	4
α-helix	597-599	3
β-strand	600-605	6	2
β-strand	608-614	7	2
α-helix	615-616	2
α-helix	617-623	7
α-helix	629-635	7
α-helix	637-649	13
α-helix	655-667	13
β-strand	669	1	9
β-strand	673	1	9
α-helix	707-719	13
β-strand	727	1	10
β-strand	729	1	11
β-strand	745	1	11
α-helix	749-768	20
α-helix	770-772	3
α-helix	787-815	29
α-helix	816-818	3
α-helix	819-829	11
α-helix	838-845	8
β-strand	848	1	10
α-helix	849-853	5
α-helix	857-872	16
α-helix	879-890	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin NUP157	A	protein	826	Saccharomyces cerevisiae	P40064 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MHC_1 Nucleoporin NUP157 (chains A)
SMESELRDVTTHVKISGLTSSEPLQLASEFVQDLSFRDRNTPILDNPDYYSKGLDYNFSD
EVGGLGAFTPFQRQQVTNIPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINN
SSEYHCIDEIEHTILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIF
NTGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSNKICLTKS
NLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYL
ITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAKIVSISMCENNDLFLAVITT
TGVRLYFKGSISRRSIGSLKLDSVKFPPTSISSSLEQNKSFIIGHHPLNTHDTGPLSTQK
ASSTYINTTCASTIISPGIYFTCVRKRANSGELSKGITNKALLENKEEHKLYVSAPDYGI
LKNYGKYVENTALLDTTDEIKEIVPLTRSFNYTSTPQGYANVFASQYSAEPLKVAVLTSN
ALEIYCYRTPDEVFESLIENPLPFIHSYGLSEACSTALYLACKFNKSEHIKSSALAFFSA
GIPGVVEIKPKSSRESGSVPPISQNLFDKSGECDGIVLSPRFYGSALLITRLFSQIWEER
VFVFKRASKTEKMDAFGISITRPQVEYYLSSISVLADFFNIHRPSFVSFVPPKGSNAITA
SDAESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKTREYFFDL
KFHDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFG

Primary citation

Structure and nucleic acid binding activity of the nucleoporin Nup157. Seo, H.S., Blus, B.J., Jankovic, N.Z. et al. Proc Natl Acad Sci U S A (2013) 110:16450-16455. DOI 10.1073/pnas.1316607110 · PubMed

Other PDB entries of the same protein (UniProt P40064 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WOO 3.71 Å, Cryo-EM structure of the inner ring protomer of the Saccharomyces cerevisiae nuclear…
7WOT 3.73 Å, Cryo-EM structure of the inner ring monomer of the Saccharomyces cerevisiae nuclear pore…
8TJ5 6.6 Å, Inner spoke ring of the yeast NPC
7N85 7.6 Å, Inner ring spoke from the isolated yeast NPC
7N9F 37.0 Å, Structure of the in situ yeast NPC
8ZZA Integrative structure and functional anatomy of a single spoke of a nuclear pore complex
8ZZB Integrative structure and functional anatomy of three spokes of a nuclear pore complex
8ZZC Integrative structure and functional anatomy of eight spokes of a nuclear pore complex
9A0F Integrative model of the wild type yeast nuclear pore complex
9A0G Integrative model of Nup116 knockout (at 25C) yeast nuclear pore complex
9A0H Integrative model of Nup116 knockout (at 37C) yeast nuclear pore complex
9A1P Comprehensive structure and functional adaptations of the yeast nuclear pore complex

Browse structure collections

About this viewer

MolViewer shows 4MHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.