4MHQ: Human primase catalytic subunit

Crystal structure of human primase catalytic subunit. Determined by X-ray diffraction at 2.2 Å resolution. Released 3 Sept 2014.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,599
Mol. weight: 50.64 kDa
Ligands: ZN, CIT
Released: 3 Sept 2014

Explore 4MHQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MHQ contains 28 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	9-15	7
α-helix	16-20	5
α-helix	23-31	9
α-helix	32-34	3
β-strand	43-48	6	1
α-helix	50-52	3
β-strand	54-58	5	1
α-helix	63-73	11
β-strand	77-84	8	1
α-helix	88-93	6
β-strand	101-103	3	1
β-strand	106-111	6	2
α-helix	112-118	7
α-helix	133-144	12
α-helix	145-149	5
β-strand	155-159	5	2
β-strand	164-169	6	2
α-helix	172-176	5
α-helix	179-189	11
α-helix	208-209	2
α-helix	210-223	14
α-helix	224-230	7
α-helix	237-244	8
α-helix	249-261	13
α-helix	265-277	13
α-helix	291-301	11
α-helix	303-304	2
α-helix	307-311	5
β-strand	317-318	2	1
β-strand	323	1	3
β-strand	329	1	4
β-strand	330	1	3
β-strand	333	1	2
α-helix	336-341	6
α-helix	344-346	3
α-helix	348	1
β-strand	349	1	4
α-helix	350-358	9
α-helix	383-385	3
α-helix	389-416	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA primase small subunit	A	protein	425	Homo sapiens	P49642 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MHQ_1 DNA primase small subunit (chains A)
GAMGSMETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYI
RYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDY
DDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVR
KLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILE
NKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWE
IMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICR
ELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSD
LQKDF

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
CIT	Citric acid	C6 H8 O7	1

Primary citation

Crystal structure of human primase catalytic subunit. Park, K.R., An, J.Y., Lee, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P49642 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6RB4 1.5 Å, Crystal structure of the Pri1 subunit of human primase
4LIK 1.7 Å, Crystal structure of the catalytic subunit of human primase
6R5E 1.85 Å, Crystal structure of the Pri1 subunit of human primase bound to 2F-ATP
6R5D 1.95 Å, Crystal structure of the Pri1 subunit of human primase bound to dATP
6R4U 2.2 Å, Crystal structure of the Pri1 subunit of human primase bound to fludarabine triphosphate
6R4T 2.35 Å, Crystal structure of the Pri1 subunit of human primase bound to vidarabine triphosphate
4LIL 2.6 Å, Crystal structure of the catalytic subunit of human primase bound to UTP and Mn
4RR2 2.65 Å, Crystal structure of human primase
4BPU 2.7 Å, Crystal structure of human primase in heterodimeric form, comprising PriS and truncated…
6R4S 2.75 Å, Crystal structure of the Pri1 subunit of human primase bound to ATP
8VY3 2.98 Å, Human DNA polymerase alpha/primase - AavLEA1 (1:40 molar ratio)
4BPW 3.0 Å, Crystal structure of human primase bound to UTP

Browse structure collections

About this viewer

MolViewer shows 4MHQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.