Crystal structure of the Pri1 subunit of human primase bound to ATP. Determined by X-ray diffraction at 2.75 Å resolution. Released 11 Sept 2019.
Explore 6R4S in 3D Show helices and sheets RCSB PDB PDBe
6R4S contains 56 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-19 | 11 | |
| α-helix | 23-31 | 9 | |
| α-helix | 32-34 | 3 | |
| β-strand | 43-48 | 6 | 1 |
| α-helix | 50-52 | 3 | |
| β-strand | 54-58 | 5 | 1 |
| α-helix | 63-73 | 11 | |
| β-strand | 77-84 | 8 | 1 |
| α-helix | 88-90 | 3 | |
| α-helix | 95 | 1 | |
| β-strand | 101-103 | 3 | 1 |
| β-strand | 106-111 | 6 | 2 |
| α-helix | 112-118 | 7 | |
| α-helix | 133-144 | 12 | |
| α-helix | 145-149 | 5 | |
| β-strand | 155-159 | 5 | 2 |
| β-strand | 164-169 | 6 | 2 |
| α-helix | 172-175 | 4 | |
| α-helix | 179-188 | 10 | |
| α-helix | 208-209 | 2 | |
| α-helix | 210-225 | 16 | |
| α-helix | 226-230 | 5 | |
| α-helix | 237-244 | 8 | |
| α-helix | 249-251 | 3 | |
| α-helix | 252-261 | 10 | |
| α-helix | 265-276 | 12 | |
| α-helix | 291-301 | 11 | |
| α-helix | 303-305 | 3 | |
| α-helix | 307-311 | 5 | |
| β-strand | 317-318 | 2 | 1 |
| α-helix | 319 | 1 | |
| β-strand | 323 | 1 | 3 |
| β-strand | 329 | 1 | 4 |
| β-strand | 330 | 1 | 3 |
| β-strand | 333 | 1 | 2 |
| α-helix | 336-341 | 6 | |
| α-helix | 348 | 1 | |
| β-strand | 349 | 1 | 4 |
| α-helix | 350-357 | 8 | |
| α-helix | 383-385 | 3 | |
| α-helix | 389-404 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-19 | 11 | |
| α-helix | 23-31 | 9 | |
| α-helix | 32-34 | 3 | |
| β-strand | 43-48 | 6 | 5 |
| α-helix | 50-52 | 3 | |
| β-strand | 54-58 | 5 | 5 |
| α-helix | 63-73 | 11 | |
| β-strand | 77-84 | 8 | 5 |
| α-helix | 88-90 | 3 | |
| α-helix | 95 | 1 | |
| β-strand | 101-103 | 3 | 5 |
| β-strand | 106-111 | 6 | 6 |
| α-helix | 112-115 | 4 | |
| α-helix | 133-144 | 12 | |
| α-helix | 145-149 | 5 | |
| β-strand | 155-159 | 5 | 6 |
| β-strand | 164-169 | 6 | 6 |
| α-helix | 172-175 | 4 | |
| α-helix | 179-188 | 10 | |
| α-helix | 208-209 | 2 | |
| α-helix | 210-225 | 16 | |
| α-helix | 226-230 | 5 | |
| α-helix | 237-244 | 8 | |
| α-helix | 249-251 | 3 | |
| α-helix | 252-261 | 10 | |
| α-helix | 265-277 | 13 | |
| α-helix | 291-301 | 11 | |
| α-helix | 303-305 | 3 | |
| β-strand | 306 | 1 | 6 |
| α-helix | 307-311 | 5 | |
| β-strand | 317-318 | 2 | 5 |
| α-helix | 319 | 1 | |
| β-strand | 323 | 1 | 7 |
| β-strand | 329 | 1 | 8 |
| β-strand | 330 | 1 | 7 |
| β-strand | 333 | 1 | 6 |
| α-helix | 336-341 | 6 | |
| α-helix | 348 | 1 | |
| β-strand | 349 | 1 | 8 |
| α-helix | 350-358 | 9 | |
| α-helix | 383-385 | 3 | |
| α-helix | 389-404 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA primase small subunit | A, E | protein | 410 | Homo sapiens | P49642 (AlphaFold model) |
>6R4S_1 DNA primase small subunit (chains A, E) GTSMETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRY QSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDD VRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKL SSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENK ESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIM LQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICREL DAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
| MN | Manganese (II) ion | Mn | 4 |
| ATP | Adenosine-5'-triphosphate | C10 H16 N5 O13 P3 | 2 |
Structural Basis for Inhibition of Human Primase by Arabinofuranosyl Nucleoside Analogues Fludarabine and Vidarabine. Holzer, S., Rzechorzek, N.J., Short, I.R. et al. ACS Chem Biol (2019) 14:1904-1912. DOI 10.1021/acschembio.9b00367 · PubMed
Other PDB entries of the same protein (UniProt P49642 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6R4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.