Crystal structure of the EZH2 SET domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Jan 2014.
Explore 4MI5 in 3D Show helices and sheets RCSB PDB PDBe
4MI5 contains 9 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 526-528 | 3 | |
| α-helix | 540-543 | 4 | |
| β-strand | 548 | 1 | 1 |
| β-strand | 561 | 1 | 1 |
| β-strand | 570 | 1 | 2 |
| α-helix | 577-580 | 4 | |
| β-strand | 583 | 1 | 3 |
| β-strand | 606 | 1 | 2 |
| α-helix | 610-613 | 4 | |
| β-strand | 619-623 | 5 | 4 |
| β-strand | 629-633 | 5 | 4 |
| β-strand | 637 | 1 | 5 |
| β-strand | 642-645 | 4 | 3 |
| β-strand | 649-652 | 4 | 6 |
| α-helix | 653-661 | 9 | |
| β-strand | 671-673 | 3 | 6 |
| β-strand | 678-681 | 4 | 6 |
| α-helix | 688-691 | 4 | |
| α-helix | 692 | 1 | |
| β-strand | 693-694 | 2 | 7 |
| β-strand | 700-707 | 8 | 3 |
| β-strand | 710-717 | 8 | 3 |
| β-strand | 721 | 1 | 5 |
| α-helix | 725 | 1 | |
| β-strand | 726 | 1 | 4 |
| α-helix | 727 | 1 | |
| β-strand | 728-729 | 2 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase EZH2 | A | protein | 229 | Homo sapiens | Q15910 (AlphaFold model) |
>4MI5_1 Histone-lysine N-methyltransferase EZH2 (chains A) GSLQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAV RECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEF ISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYA KVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 6 |
Water and common crystallization additives (SO4) are not listed.
Structural Context of Disease-Associated Mutations and Putative Mechanism of Autoinhibition Revealed by X-Ray Crystallographic Analysis of the EZH2-SET Domain. Antonysamy, S., Condon, B., Druzina, Z. et al. PLoS One (2013) 8:e84147-e84147. DOI 10.1371/journal.pone.0084147 · PubMed
Other PDB entries of the same protein (UniProt Q15910 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4MI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.