4MO3: Coagulation factor VIII

Crystal Structure of Porcine C2 Domain of Blood Coagulation Factor VIII. Determined by X-ray diffraction at 1.7 Å resolution. Released 6 Nov 2013.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Sus scrofa
Chains: 1
Atoms: 1,442
Mol. weight: 20 kDa
Released: 6 Nov 2013

Explore 4MO3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MO3 contains 3 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain M: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2176-2177	2	1
α-helix	2187-2189	3
β-strand	2190-2192	3	1
β-strand	2197	1	2
β-strand	2202	1	2
α-helix	2205-2207	3
β-strand	2209	1	1
β-strand	2219	1	3
β-strand	2230-2246	17	1
β-strand	2248-2250	3	4
β-strand	2253-2255	3	4
β-strand	2256-2265	10	1
β-strand	2272-2273	2	1
β-strand	2275-2276	2	5
β-strand	2279-2280	2	5
α-helix	2281-2282	2
β-strand	2283-2284	2	1
β-strand	2293-2314	22	1
β-strand	2319	1	3
β-strand	2320-2326	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII	M	protein	177	Sus scrofa	P12263 (AlphaFold model)

Sequence of entity 1 (M), FASTA

>4MO3_1 Coagulation factor VIII (chains M)
MGSSHHHHHHENLYFQGSDLNSCSMPLGMQNKAISDSQITASSHLSNIFATWSPSQARLH
LQGRTNAWRPRVSSAEEWLQVDLQKTVKVTGITTQGVKSLLSSMYVKEFLVSSSQDGRRW
TLFLQDGHTKVFQGNQDSSTPVVNALDPPLFTRYLRIHPTSWAQHIALRLEVLGCEA

Primary citation

Crystal Structure of Porcine C2 Domain of Blood Coagulation Factor VIII (FoldIt Target). Spiegel, P.C., Brison, C. To be published.

Other PDB entries of the same protein (UniProt P12263 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S0P 1.3 Å, Crystal structure of Porcine Factor VIII C2 Domain Bound to Phosphatidylserine
6MF0 3.2 Å, Crystal Structure Determination of Human/Porcine Chimera Coagulation Factor VIII
8TY1 3.46 Å, Cryo-EM structure of coagulation factor VIII bound to NB2E9
7K66 3.92 Å, Structure of Blood Coagulation Factor VIII in Complex with an Anti-C1 Domain Pathogenic…
7KBT 4.15 Å, Factor VIII in complex with the anti-C2 domain antibody, G99
8G6I 4.23 Å, Coagulation factor VIII bound to a patient-derived anti-C1 domain antibody inhibitor

Browse structure collections

About this viewer

MolViewer shows 4MO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.