7KBT: Factor VIII

Factor VIII in complex with the anti-C2 domain antibody, G99. Determined by X-ray diffraction at 4.15 Å resolution. Released 18 Nov 2020.

Method: X-ray diffraction
Resolution: 4.15 Å
Organisms: Sus scrofa, Homo sapiens, Mus musculus
Chains: 3
Atoms: 11,366
Mol. weight: 217.12 kDa
Ligands: CA, ZN, CU, NAG
Released: 18 Nov 2020

Explore 7KBT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KBT contains 24 α-helices and 144 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 117 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	13	1	2
α-helix	21-23	3
β-strand	48	1	2
β-strand	55	1	3
β-strand	63	1	3
α-helix	73	1
β-strand	74-78	5	4
β-strand	84-87	4	1
β-strand	88	1	5
β-strand	91	1	6
β-strand	97	1	7
β-strand	100-101	2	4
α-helix	122-124	3
β-strand	129	1	7
β-strand	132	1	6
β-strand	136	1	5
β-strand	139	1	1
α-helix	143-145	3
β-strand	154-160	7	4
α-helix	165-169	5
β-strand	175-180	6	4
β-strand	198-201	4	8
β-strand	202-203	2	9
α-helix	205-207	3
β-strand	232-233	2	9
β-strand	235	1	10
β-strand	238	1	10
β-strand	247-249	3	11
β-strand	253-261	9	8
β-strand	268-272	5	11
β-strand	277-279	3	8
β-strand	282-284	3	8
β-strand	287-289	3	11
β-strand	294-300	7	8
β-strand	305-311	7	11
β-strand	322-328	7	11
β-strand	381-394	14	12
β-strand	415	1	13
β-strand	418	1	13
β-strand	422-431	10	12
β-strand	439	1	12
β-strand	453	1	14
β-strand	456	1	15
β-strand	460-466	7	12
β-strand	473	1	16
β-strand	476-478	3	14
β-strand	483-485	3	12
β-strand	503	1	16
β-strand	508-514	7	12
α-helix	517-519	3
β-strand	529-534	6	14
α-helix	539-545	7
β-strand	549-553	5	14
β-strand	554	1	15
β-strand	573-580	8	17
α-helix	587-594	8
α-helix	606-609	4
β-strand	613-617	5	17
β-strand	620	1	17
β-strand	626	1	18
β-strand	634-641	8	17
β-strand	649-653	5	19
β-strand	659	1	17
β-strand	664	1	17
β-strand	667-670	4	19
β-strand	674-681	8	17
β-strand	687	1	20
β-strand	689	1	18
β-strand	690-691	2	19
α-helix	698-700	3
β-strand	705	1	18
β-strand	1695-1707	13	21
β-strand	1730-1738	9	21
α-helix	1754-1756	3
β-strand	1763-1765	3	22
β-strand	1770-1777	8	21
β-strand	1783	1	23
β-strand	1786	1	24
β-strand	1802	1	20
β-strand	1807	1	23
β-strand	1814-1818	5	21
α-helix	1819-1820	2
α-helix	1821-1823	3
β-strand	1832-1837	6	22
β-strand	1838	1	24
α-helix	1845-1848	4
β-strand	1853-1858	6	22
β-strand	1864	1	25
β-strand	1869	1	25
β-strand	1874-1884	11	26
α-helix	1889-1894	6
β-strand	1917-1921	5	26
β-strand	1924	1	26
β-strand	1933-1935	3	27
β-strand	1940-1946	7	26
β-strand	1955-1958	4	27
β-strand	1963-1967	5	26
β-strand	1969-1973	5	26
β-strand	1975-1977	3	27
β-strand	1983-1988	6	26
β-strand	1994-2000	7	27
α-helix	2003-2007	5
β-strand	2011-2017	7	27
β-strand	2023-2024	2	28
α-helix	2034-2036	3
β-strand	2037-2038	2	28
α-helix	2048-2050	3
β-strand	2052	1	28
β-strand	2062-2064	3	29
β-strand	2071-2086	16	28
β-strand	2090-2091	2	30
β-strand	2094-2095	2	30
β-strand	2097-2106	10	28
β-strand	2113-2114	2	28
α-helix	2124-2125	2
β-strand	2126-2127	2	28
β-strand	2136-2157	22	28
β-strand	2160-2162	3	29
β-strand	2164-2169	6	28
β-strand	2177	1	31
β-strand	2190-2192	3	31
α-helix	2205-2207	3
β-strand	2209	1	31
β-strand	2219	1	32
β-strand	2230-2246	17	31
β-strand	2248	1	33
β-strand	2255	1	33
β-strand	2256-2265	10	31
β-strand	2272-2273	2	31
β-strand	2275-2276	2	34
β-strand	2279-2280	2	34
β-strand	2283-2284	2	31
β-strand	2293	1	31
β-strand	2296	1	31
α-helix	2300-2301	2
β-strand	2302-2314	13	31
β-strand	2319	1	32
β-strand	2320-2326	7	31

Chain E: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	35
β-strand	12	1	36
β-strand	23	1	37
β-strand	25	1	35
β-strand	33-35	3	38
β-strand	50-51	2	38
β-strand	58-59	2	38
α-helix	63-66	4
β-strand	69-73	5	37
β-strand	78-82	5	37
β-strand	92-93	2	39
β-strand	97-99	3	38
β-strand	112	1	38
β-strand	117-118	2	39
β-strand	120	1	36

Chain F: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	40
β-strand	10	1	41
β-strand	22-24	3	40
β-strand	33-35	3	42
β-strand	38	1	43
β-strand	44	1	43
β-strand	48-49	2	42
β-strand	66-67	2	40
β-strand	70-71	2	40
β-strand	85-86	2	41
β-strand	88-90	3	42
α-helix	96	1
β-strand	97	1	42
β-strand	102-103	2	41

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII,Coagulation factor VIII,Coagulation factor VIII,Coagulation factor…	A	protein	1467	Sus scrofa, Homo sapiens	P00451 (AlphaFold model), P12263 (AlphaFold model)
G99 heavy chain	E	protein	224	Mus musculus
G99 light chain	F	protein	214	Mus musculus

Sequence of entity 1 (A), FASTA

>7KBT_1 Coagulation factor VIII,Coagulation factor VIII,Coagulation factor VIII,Coagulation factor VIII,Coagulation factor VIII (chains A)
MQLELSTCVFLCLLPLGFSAIRRYYLGAVELSWDYRQSELLRELHVDTRFPATAPGALPL
GPSVLYKKTVFVEFTDQLFSVARPRPPWMGLLGPTIQAEVYDTVVVTLKNMASHPVSLHA
VGVSFWKSSEGAEYEDHTSQREKEDDKVLPGKSQTYVWQVLKENGPTASDPPCLTYSYLS
HVDLVKDLNSGLIGALLVCREGSLTRERTQNLHEFVLLFAVFDEGKSWHSARNDSWTRAM
DPAPARAQPAMHTVNGYVNRSLPGLIGCHKKSVYWHVIGMGTSPEVHSIFLEGHTFLVRH
HRQASLEISPLTFLTAQTFLMDLGQFLLFCHISSHHHGGMEAHVRVESCAEEPQLRRKAD
EEEDYDDNLYDSDMDVVRLDGDDVSPFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLA
PDDRSYKSQYLNNGPQRIGRKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTL
LIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGP
TKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDE
NRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILS
IGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRG
MTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFAQNSRPPSASAPKPPVLRR
HQRDISLPTFQPEEDKMDYDDIFSTETKGEDFDIYGEDENQDPRSFQKRTRHYFIAAVEQ
LWDYGMSESPRALRNRAQNGEVPRFKKVVFREFADGSFTQPSYRGELNKHLGLLGPYIRA
EVEDNIMVTFKNQASRPYSFYSSLISYPDDQEQGAEPRHNFVQPNETRTYFWKVQHHMAP
TEDEFDCKAWAYFSDVDLEKDVHSGLIGPLLICRANTLNAAHGRQVTVQEFALFFTIFDE
TKSWYFTENVERNCRAPCHLQMEDPTLKENYRFHAINGYVMDTLPGLVMAQNQRIRWYLL
SMGSNENIHSIHFSGHVFSVRKKEEYKMAVYNLYPGVFETVEMLPSKVGIWRIECLIGEH
LQAGMSTTFLVYSKKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTK
EPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMV
FFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAI
SDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTT
QGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRY
LRIHPQSWVHQIALRMEVLGCEAQDLY

Sequence of entity 2 (E), FASTA

>7KBT_2 G99 heavy chain (chains E)
QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSTNY
NERFKGKASFTADSSSNTAYMQLSSLTSEDSAVYYCTRTSYYFGSSYDFDVWGAGTTVTV
SSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQ
SDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP

Sequence of entity 3 (F), FASTA

>7KBT_3 G99 light chain (chains F)
DIQMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQQKPDGTIKRLIYAASTLDSSVPK
RFSGSRSGSDYSLTISSLDSEDFAVYYCLQYASYPYTFGGGTKVEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
ZN	Zinc ion	Zn	1
CU	Copper (II) ion	Cu	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Structure of Blood Coagulation Factor VIII in Complex With an Anti-C2 Domain Non-Classical, Pathogenic Antibody Inhibitor. Ronayne, E.K., Peters, S.C., Gish, J.S. et al. Front Immunol (2021) 12:2260. DOI 10.3389/fimmu.2021.697602

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
3HNB 1.15 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
1IQD 2.0 Å, Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4PT6 2.1 Å, The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
7KWO 2.9 Å, Rfviiifc-vwf-xten (BIVV001)
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
9JBV 3.17 Å, Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation…

Browse structure collections

About this viewer

MolViewer shows 7KBT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.