4MPM: Wild-type human neuroglobin

Wild-type human neuroglobin. Determined by X-ray diffraction at 1.74 Å resolution. Released 15 Jan 2014.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,663
Mol. weight: 35.14 kDa
Ligands: HEM
Released: 15 Jan 2014

Explore 4MPM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MPM contains 22 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	6-13	8
α-helix	20-34	15
α-helix	38-49	12
α-helix	55-57	3
α-helix	59-77	19
α-helix	79-85	7
α-helix	86-98	13
α-helix	105-121	17
α-helix	122-124	3
α-helix	127-144	18
α-helix	145-148	4

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	6-16	11
α-helix	20-34	15
α-helix	36-42	7
α-helix	52-57	6
α-helix	59-77	19
α-helix	79-85	7
α-helix	86-99	14
α-helix	105-121	17
α-helix	122-124	3
α-helix	127-145	19
α-helix	146-148	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuroglobin	A, B	protein	151	Homo sapiens	Q9NPG2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4MPM_1 Neuroglobin (chains A, B)
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPE
FLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKC
LGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	2

Primary citation

The crystal structure of wild-type human brain neuroglobin reveals flexibility of the disulfide bond that regulates oxygen affinity. Guimaraes, B.G., Hamdane, D., Lechauve, C. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:1005-1014. DOI 10.1107/S1399004714000078 · PubMed

Other PDB entries of the same protein (UniProt Q9NPG2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VQG 1.35 Å, The X-ray structure of human neuroglobin A15C mutant
8WUB 1.5 Å, The X-ray structure of human neuroglobin C120S mutant
1OJ6 1.95 Å, Human brain neuroglobin three-dimensional structure
8GRZ 2.0 Å, X-ray crystal structure of V71C human neuroglobin mutant

Browse structure collections

About this viewer

MolViewer shows 4MPM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.