8WUB: Human neuroglobin C120S mutant

The X-ray structure of human neuroglobin C120S mutant. Determined by X-ray diffraction at 1.5 Å resolution. Released 23 Oct 2024.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,209
Mol. weight: 53.23 kDa
Ligands: HEM
Released: 23 Oct 2024

Explore 8WUB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WUB contains 31 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	6-18	13
α-helix	20-34	15
α-helix	38-45	8
α-helix	52-56	5
α-helix	59-77	19
α-helix	82-85	4
α-helix	86-98	13
α-helix	105-121	17
α-helix	122-124	3
α-helix	127-144	18
α-helix	145-147	3

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	6-17	12
α-helix	20-34	15
α-helix	38-45	8
α-helix	52-56	5
α-helix	59-77	19
α-helix	82-85	4
α-helix	86-98	13
α-helix	105-121	17
α-helix	122-124	3
α-helix	127-145	19

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	6-18	13
α-helix	20-34	15
α-helix	38-45	8
α-helix	52-57	6
α-helix	59-77	19
α-helix	82-85	4
α-helix	86-98	13
α-helix	104-121	18
α-helix	122-124	3
α-helix	127-145	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuroglobin	A, B, C	protein	151	Homo sapiens	Q9NPG2 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8WUB_1 Neuroglobin (chains A, B, C)
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPE
FLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKS
LGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	3

Water and common crystallization additives (SO4) are not listed.

Primary citation

The X-ray structure of human neuroglobin C120S mutant. Lin, Y.W., Yuan, H. To be published.

Other PDB entries of the same protein (UniProt Q9NPG2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VQG 1.35 Å, The X-ray structure of human neuroglobin A15C mutant
4MPM 1.74 Å, Wild-type human neuroglobin
1OJ6 1.95 Å, Human brain neuroglobin three-dimensional structure
8GRZ 2.0 Å, X-ray crystal structure of V71C human neuroglobin mutant

Browse structure collections

About this viewer

MolViewer shows 8WUB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.