1DPU: C-terminal domain of human RPA32

Solution structure of the C-terminal domain of human RPA32 complexed with UNG2(73-88). Determined by solution NMR. Released 10 Nov 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 665
Mol. weight: 12.41 kDa
Released: 10 Nov 2000

Explore 1DPU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DPU contains 4 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	207-218	12
β-strand	225-226	2	1
α-helix	227-233	7
α-helix	239-251	13
β-strand	255-257	3	1
β-strand	263-266	4	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	77-86	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replication protein A (RPA32) C-terminal domain	A	protein	99	Homo sapiens	P15927 (AlphaFold model)
Uracil DNA glycosylase (UNG2)	B	protein	16		P13051 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DPU_1 REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN (chains A)
ANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLK
NQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE

Sequence of entity 2 (B), FASTA

>1DPU_2 URACIL DNA GLYCOSYLASE (UNG2) (chains B)
RIQRNKAAALLRLAAR

Primary citation

Structural basis for the recognition of DNA repair proteins UNG2, XPA, and RAD52 by replication factor RPA. Mer, G., Bochkarev, A., Gupta, R. et al. Cell (2000) 103:449-456. DOI 10.1016/S0092-8674(00)00136-7 · PubMed

Other PDB entries of the same protein (UniProt P15927 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OU0 1.4 Å, Crystal Structure of RPA32C
4MQV 1.95 Å, Crystal complex of Rpa32c and Smarcal1 N-terminus
3KDF 1.98 Å, X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell…
2PI2 2.0 Å, Full-length Replication protein A subunits RPA14 and RPA32
1QUQ 2.5 Å, Complex of replication protein A subunits RPA14 and RPA32
2PQA 2.5 Å, Crystal Structure of Full-length Human RPA 14/32 Heterodimer
1L1O 2.8 Å, Structure of the human Replication Protein A (RPA) trimerization core
2Z6K 3.0 Å, Crystal structure of full-length human RPA14/32 heterodimer
8RK2 3.2 Å, Human Replication protein A (RPA; trimeric core) - ssDNA complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9MJ5 3.5 Å, Catalytic domain of human DNA polymerase alpha in complex with DNA and RPA

Browse structure collections

About this viewer

MolViewer shows 1DPU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.