Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with AF40431. Determined by X-ray diffraction at 2.7 Å resolution. Released 12 Feb 2014.
Explore 4MSL in 3D Show helices and sheets RCSB PDB PDBe
4MSL contains 21 α-helices and 61 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 59-64 | 6 | |
| β-strand | 67-71 | 5 | 1 |
| β-strand | 79-84 | 6 | 2 |
| β-strand | 90-96 | 7 | 2 |
| β-strand | 109-114 | 6 | 2 |
| β-strand | 122-123 | 2 | 2 |
| α-helix | 125-128 | 4 | |
| α-helix | 132 | 1 | |
| β-strand | 133 | 1 | 3 |
| α-helix | 134 | 1 | |
| α-helix | 135-137 | 3 | |
| β-strand | 139-141 | 3 | 3 |
| α-helix | 142 | 1 | |
| β-strand | 149-153 | 5 | 3 |
| β-strand | 163-167 | 5 | 3 |
| β-strand | 175-178 | 4 | 3 |
| β-strand | 183 | 1 | 4 |
| β-strand | 188-189 | 2 | 5 |
| β-strand | 197-200 | 4 | 5 |
| β-strand | 201 | 1 | 4 |
| β-strand | 206-209 | 4 | 5 |
| β-strand | 217-220 | 4 | 5 |
| β-strand | 225-228 | 4 | 6 |
| β-strand | 234-238 | 5 | 6 |
| β-strand | 251-256 | 6 | 6 |
| β-strand | 264-276 | 13 | 6 |
| β-strand | 279-285 | 7 | 6 |
| α-helix | 286 | 1 | |
| β-strand | 292-297 | 6 | 6 |
| β-strand | 305-306 | 2 | 6 |
| α-helix | 310-311 | 2 | |
| β-strand | 312 | 1 | 6 |
| β-strand | 318-324 | 7 | 7 |
| β-strand | 327-333 | 7 | 7 |
| α-helix | 334 | 1 | |
| β-strand | 340-346 | 7 | 7 |
| β-strand | 353-361 | 9 | 7 |
| β-strand | 372-373 | 2 | 7 |
| β-strand | 381-386 | 6 | 7 |
| β-strand | 392-397 | 6 | 7 |
| β-strand | 405-406 | 2 | 7 |
| β-strand | 407 | 1 | 8 |
| α-helix | 408-410 | 3 | |
| β-strand | 426-429 | 4 | 8 |
| α-helix | 432-436 | 5 | |
| β-strand | 446 | 1 | 8 |
| β-strand | 455-462 | 8 | 8 |
| β-strand | 471-475 | 5 | 8 |
| β-strand | 483-486 | 4 | 8 |
| β-strand | 490-495 | 6 | 9 |
| α-helix | 496-498 | 3 | |
| β-strand | 500-505 | 6 | 9 |
| β-strand | 511 | 1 | 10 |
| β-strand | 513-517 | 5 | 9 |
| β-strand | 525-528 | 4 | 9 |
| β-strand | 534 | 1 | 10 |
| β-strand | 535-541 | 7 | 1 |
| β-strand | 549-555 | 7 | 1 |
| β-strand | 564-570 | 7 | 1 |
| β-strand | 578 | 1 | 11 |
| α-helix | 579 | 1 | |
| α-helix | 581-583 | 3 | |
| β-strand | 584-588 | 5 | 12 |
| β-strand | 602 | 1 | 12 |
| β-strand | 605-612 | 8 | 12 |
| β-strand | 619 | 1 | 11 |
| β-strand | 628-632 | 5 | 12 |
| α-helix | 633 | 1 | |
| β-strand | 634-635 | 2 | 13 |
| α-helix | 637-639 | 3 | |
| β-strand | 640-642 | 3 | 14 |
| α-helix | 643 | 1 | |
| β-strand | 646-647 | 2 | 15 |
| β-strand | 656-657 | 2 | 15 |
| α-helix | 663-671 | 9 | |
| α-helix | 674-677 | 4 | |
| β-strand | 678-679 | 2 | 16 |
| β-strand | 682-684 | 3 | 14 |
| α-helix | 685 | 1 | |
| β-strand | 691-693 | 3 | 13 |
| β-strand | 701-702 | 2 | 16 |
| α-helix | 704-708 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sortilin | A | protein | 696 | Homo sapiens | Q99523 (AlphaFold model) |
>4MSL_1 Sortilin (chains A) SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIM TFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRI FRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVC LAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIF TSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRW THLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDA ISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDY TIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSMCQNGRDYVVTKQPSICLCSLEDFLCDF GYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLK KKCTSNFLSPEKQNSKSNSGSAMIEGRGVGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| 2ET | N-[(7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl]-L-leucine | C17 H21 N O5 | 1 |
Water and common crystallization additives (PG4) are not listed.
Identification of the first small-molecule ligand of the neuronal receptor sortilin and structure determination of the receptor-ligand complex. Andersen, J.L., Schrder, T.J., Christensen, S. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:451-460. DOI 10.1107/S1399004713030149 · PubMed
Other PDB entries of the same protein (UniProt Q99523 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4MSL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.