3G2V: VHS Domain of human GGA1

VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 15 Dec 2009.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,548
Mol. weight: 37.7 kDa
Released: 15 Dec 2009

Explore 3G2V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3G2V contains 20 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-17	8
α-helix	27-37	11
α-helix	43-55	13
α-helix	60-76	17
α-helix	80-85	6
α-helix	88-98	11
α-helix	104-106	3
α-helix	109-125	17
α-helix	130-141	12

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-17	8
α-helix	27-37	11
α-helix	43-55	13
α-helix	60-75	16
α-helix	79-85	7
α-helix	88-98	11
α-helix	104-106	3
α-helix	109-125	17
α-helix	130-141	12

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor-binding protein GGA1	A, B	protein	149	Homo sapiens	Q9UJY5 (AlphaFold model)
C-terminal fragment of Sortilin	C, D	protein	13		Q99523 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3G2V_1 ADP-ribosylation factor-binding protein GGA1 (chains A, B)
GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSP
QEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILEL
LYSWTVGLPEEVKIAEAYQMLKKQGIVKS

Sequence of entity 2 (C, D), FASTA

>3G2V_2 C-terminal fragment of Sortilin (chains C, D)
SGYHDDSDEDLLE

Primary citation

GGA autoinhibition revisited. Cramer, J.F., Gustafsen, C., Behrens, M.A. et al. Traffic (2010) 11:259-273. DOI 10.1111/j.1600-0854.2009.01017.x · PubMed

Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2J 1.6 Å, Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
1UJK 1.9 Å, VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
1JWF 2.1 Å, Crystal Structure of human GGA1 VHS domain.
1O3X 2.1 Å, Crystal structure of human GGA1 GAT domain
1NA8 2.3 Å, Crystal structure of ADP-ribosylation factor binding protein GGA1
2DWY 2.3 Å, Crystal Structure Analysis of GGA1-GAE
3G2U 2.3 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide
1NWM 2.4 Å, GAT domain of human GGA1
3G2W 2.4 Å, VHS Domain of human GGA1 complexed with a DXXLL hinge peptide

Browse structure collections

About this viewer

MolViewer shows 3G2V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.