Crystal structure of human Spindlin1 bound to histone H3K4me3 peptide. Determined by X-ray diffraction at 1.7 Å resolution. Released 26 Mar 2014.
Explore 4MZG in 3D Show helices and sheets RCSB PDB PDBe
4MZG contains 14 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| α-helix | 4-7 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 56-62 | 7 | 2 |
| α-helix | 68-69 | 2 | |
| β-strand | 70-79 | 10 | 2 |
| β-strand | 87-91 | 5 | 2 |
| β-strand | 96 | 1 | 1 |
| β-strand | 97-100 | 4 | 2 |
| β-strand | 108-117 | 10 | 2 |
| α-helix | 118-119 | 2 | |
| α-helix | 126-132 | 7 | |
| β-strand | 136-142 | 7 | 1 |
| β-strand | 148-158 | 11 | 1 |
| α-helix | 159 | 1 | |
| β-strand | 166-170 | 5 | 1 |
| β-strand | 173-174 | 2 | 1 |
| β-strand | 175 | 1 | 3 |
| β-strand | 176-179 | 4 | 1 |
| α-helix | 181-186 | 6 | |
| β-strand | 190-192 | 3 | 1 |
| α-helix | 193-194 | 2 | |
| β-strand | 217-221 | 5 | 3 |
| β-strand | 227-235 | 9 | 3 |
| β-strand | 242-247 | 6 | 3 |
| β-strand | 252 | 1 | 2 |
| β-strand | 254-257 | 4 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 4 |
| α-helix | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 57-62 | 6 | 5 |
| α-helix | 68-69 | 2 | |
| β-strand | 70-80 | 11 | 5 |
| β-strand | 83-91 | 9 | 5 |
| β-strand | 96 | 1 | 4 |
| β-strand | 97-100 | 4 | 5 |
| β-strand | 108-113 | 6 | 5 |
| α-helix | 121-123 | 3 | |
| α-helix | 126-132 | 7 | |
| β-strand | 136-142 | 7 | 4 |
| β-strand | 148-158 | 11 | 4 |
| α-helix | 159 | 1 | |
| β-strand | 166-170 | 5 | 4 |
| β-strand | 173-174 | 2 | 4 |
| β-strand | 175 | 1 | 6 |
| β-strand | 176-179 | 4 | 4 |
| α-helix | 181-186 | 6 | |
| β-strand | 190-192 | 3 | 4 |
| α-helix | 193-194 | 2 | |
| β-strand | 217-219 | 3 | 6 |
| β-strand | 229-235 | 7 | 6 |
| β-strand | 242-247 | 6 | 6 |
| β-strand | 252 | 1 | 5 |
| β-strand | 254-257 | 4 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptide from Histone H3.2 | A, C | protein | 20 | Homo sapiens | Q71DI3 (AlphaFold model) |
| Spindlin-1 | B, D | protein | 222 | Homo sapiens | Q9Y657 (AlphaFold model) |
>4MZG_1 Peptide from Histone H3.2 (chains A, C) ARTKQTARKSTGGKAPRKQL
>4MZG_2 Spindlin-1 (chains B, D) HHHHHHGSMRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGL ELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAP VMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEY AKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
Water and common crystallization additives (CL, MPD) are not listed.
Molecular basis underlying histone H3 lysine-arginine methylation pattern readout by Spin/Ssty repeats of Spindlin1. Su, X., Zhu, G., Ding, X. et al. Genes Dev (2014) 28:622-636. DOI 10.1101/gad.233239.113 · PubMed
Other PDB entries of the same protein (UniProt Q71DI3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4MZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.