2X4W: Peregrin

Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Determined by X-ray diffraction at 1.5 Å resolution. Released 21 Apr 2010.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,339
Mol. weight: 17.63 kDa
Released: 21 Apr 2010

Explore 2X4W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X4W contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1088-1091	4	1
β-strand	1099-1104	6	1
β-strand	1113-1115	3	2
β-strand	1118-1120	3	2
α-helix	1121-1124	4
α-helix	1125-1138	14
β-strand	1143-1147	5	1
β-strand	1154-1157	4	1
α-helix	1159-1161	3
β-strand	1162-1164	3	1
α-helix	1169-1176	8
α-helix	1182-1203	22

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	29-31	3
β-strand	35	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peregrin	A	protein	132	HOMO SAPIENS	P55201 (AlphaFold model)
Histone H3.2	B	protein	21	HOMO SAPIENS	Q71DI3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2X4W_1 PEREGRIN (chains A)
GGSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQ
MTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYH
RALQHRSKVQGE

Sequence of entity 2 (B), FASTA

>2X4W_2 HISTONE H3.2 (chains B)
TKAARKSAPATGGVKKPHRYR

Primary citation

Molecular Basis of Histone H3K36Me3 Recognition by the Pwwp Domain of Brpf1. Vezzoli, A., Bonadies, N., Allen, M.D. et al. Nat Struct Mol Biol (2010) 17:617. DOI 10.1038/NSMB.1797 · PubMed

Other PDB entries of the same protein (UniProt P55201 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MWZ 1.25 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ073
3L42 1.3 Å, PWWP domain of human bromodomain and PHD finger containing protein 1
5C6S 1.3 Å, Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a
5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
5O5F 1.3 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ038
5ETB 1.33 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED13
5D7X 1.35 Å, Crystal structure of the human BRPF1 bromodomain in complex with XZ08
7C4I 1.37 Å, High resolution structure of BRPF1 Bromo Domain from Biortus
5EM3 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED9
5ETD 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED14
8QAZ 1.4 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…
8QB2 1.42 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…

Browse structure collections

About this viewer

MolViewer shows 2X4W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.