p53 cancer mutant Y220C in complex with compound MB184. Determined by X-ray diffraction at 1.32 Å resolution. Released 9 May 2018.
Explore 5O1C in 3D Show helices and sheets RCSB PDB PDBe
5O1C contains 12 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 103 | 1 | 1 |
| β-strand | 110-112 | 3 | 2 |
| β-strand | 124-127 | 4 | 1 |
| β-strand | 132-135 | 4 | 1 |
| β-strand | 141-146 | 6 | 2 |
| α-helix | 150-152 | 3 | |
| β-strand | 156-163 | 8 | 1 |
| α-helix | 166-168 | 3 | |
| α-helix | 172-173 | 2 | |
| α-helix | 179-181 | 3 | |
| β-strand | 195-197 | 3 | 2 |
| β-strand | 204-207 | 4 | 1 |
| β-strand | 214-219 | 6 | 1 |
| α-helix | 222-224 | 3 | |
| β-strand | 230-236 | 7 | 2 |
| β-strand | 251-258 | 8 | 1 |
| β-strand | 264-274 | 11 | 1 |
| α-helix | 278-291 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 96-99 | 4 | |
| β-strand | 103 | 1 | 3 |
| β-strand | 110-112 | 3 | 4 |
| β-strand | 124-127 | 4 | 3 |
| β-strand | 132-135 | 4 | 3 |
| β-strand | 141-146 | 6 | 4 |
| α-helix | 150-152 | 3 | |
| β-strand | 156-163 | 8 | 3 |
| α-helix | 172-173 | 2 | |
| α-helix | 179-181 | 3 | |
| β-strand | 195-197 | 3 | 4 |
| β-strand | 204-207 | 4 | 3 |
| β-strand | 214-219 | 6 | 3 |
| α-helix | 222-224 | 3 | |
| β-strand | 230-236 | 7 | 4 |
| β-strand | 251-258 | 8 | 3 |
| β-strand | 264-274 | 11 | 3 |
| α-helix | 278-289 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cellular tumor antigen p53 | A, B | protein | 219 | Homo sapiens | P04637 (AlphaFold model) |
>5O1C_1 Cellular tumor antigen p53 (chains A, B) SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPP GTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFR HSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVR VCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
| 9GZ | 5-(4-fluorophenyl)-3-iodanyl-2-oxidanyl-4-pyrrol-1-yl-benzoic acid | C17 H11 F I N O3 | 2 |
Aminobenzothiazole derivatives stabilize the thermolabile p53 cancer mutant Y220C and show anticancer activity in p53-Y220C cell lines. Baud, M.G.J., Bauer, M.R., Verduci, L. et al. Eur J Med Chem (2018) 152:101-114. DOI 10.1016/j.ejmech.2018.04.035 · PubMed
Other PDB entries of the same protein (UniProt P04637 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5O1C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.