4N0E: K345L variant of the Gi alpha1 subunit

Crystal structure of the K345L variant of the Gi alpha1 subunit bound to GDP. Determined by X-ray diffraction at 2.1 Å resolution. Released 12 Mar 2014.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,804
Mol. weight: 41.07 kDa
Ligands: GDP
Released: 12 Mar 2014

Explore 4N0E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N0E contains 22 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	10-16	7
α-helix	20-23	4
α-helix	27-29	3
α-helix	30-31	2
β-strand	32-40	9	1
α-helix	46-57	12
α-helix	63-67	5
α-helix	70-90	21
α-helix	100-113	14
α-helix	121-131	11
α-helix	134-140	7
α-helix	143-145	3
α-helix	152-157	6
α-helix	159-163	5
α-helix	171-175	5
β-strand	185-191	7	1
β-strand	194-200	7	1
β-strand	220-226	7	1
α-helix	227-231	5
α-helix	242-254	13
α-helix	257-259	3
β-strand	263-269	7	1
α-helix	271-278	8
α-helix	283-285	3
α-helix	296-308	13
β-strand	319-323	5	1
α-helix	329-346	18
α-helix	348-350	3
β-strand	353	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(i) subunit alpha-1	A	protein	356	Rattus norvegicus	P10824 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4N0E_1 Guanine nucleotide-binding protein G(i) subunit alpha-1 (chains A)
GSMGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHE
AGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGF
MTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTR
VKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDE
EMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEE
AAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIILNNLKDCGLF

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

A Transient Interaction between the Phosphate Binding Loop and Switch I Contributes to the Allosteric Network between Receptor and Nucleotide in G alpha i1. Thaker, T.M., Sarwar, M., Preininger, A.M. et al. J Biol Chem (2014) 289:11331-11341. DOI 10.1074/jbc.M113.539064 · PubMed

Other PDB entries of the same protein (UniProt P10824 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CIP 1.5 Å, Gi-alpha-1 subunit of guanine nucleotide-binding protein complexed with a GTP analogue
1SVS 1.5 Å, Structure of the K180P mutant of Gi alpha subunit bound to GppNHp.
4N0D 1.55 Å, Crystal structure of the K345L variant of the Gi alpha1 subunit bound to GTPgammaS
5KDO 1.9 Å, Heterotrimeric complex of the 4 alanine insertion variant of the Gi alpha1 subunit and…
1AS0 2.0 Å, GTP-gamma-S bound G42V GIA1
1GIA 2.0 Å, Structure of active conformations of GIA1 and the mechanism of GTP hydrolysis
1SVK 2.0 Å, Structure of the K180P mutant of Gi alpha subunit bound to AlF4 and GDP
4PAQ 2.0 Å, A conserved phenylalanine as relay between the 5 helix and the GDP binding region of…
4PAO 2.0 Å, A conserved phenylalanine as relay between the 5 helix and the GDP binding region of…
1FQJ 2.02 Å, Crystal structure of the heterotrimeric complex of the rgs domain of RGS9, the gamma…
6M8H 2.07 Å, Crystal Structure of the R208Q mutant of G(i) subunit alpha-1
1BH2 2.1 Å, A326S mutant of an inhibitory alpha subunit

Browse structure collections

About this viewer

MolViewer shows 4N0E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.