4N4A: Cap-specific mRNA-methyltransferase 1

Name: PDB 4N4A: Cystal structure of Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
Published: 2014-01-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Cystal structure of Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1. Determined by X-ray diffraction at 2.35 Å resolution. Released 22 Jan 2014.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,569
Mol. weight: 48.94 kDa
Released: 22 Jan 2014

Explore 4N4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N4A contains 20 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	157	1	1
α-helix	158-161	4
α-helix	164-166	3
β-strand	176-179	4	2
α-helix	184-186	3
α-helix	193-208	16
α-helix	211-221	11
α-helix	225-228	4
α-helix	235-246	12
β-strand	255	1	3
β-strand	261	1	3
α-helix	269-270	2
β-strand	271-277	7	1
α-helix	282-291	10
α-helix	292-294	3
β-strand	295-301	7	1
β-strand	321-323	3	1
α-helix	339-351	13
β-strand	358-364	7	1
α-helix	373-375	3
α-helix	376-379	4
α-helix	381-394	14
β-strand	395-405	11	1
α-helix	411-423	13
β-strand	424-430	7	1
β-strand	442-449	8	1
α-helix	450	1
α-helix	454-470	17
β-strand	475-479	5	2
α-helix	483-488	6
α-helix	490-519	30
α-helix	528-539	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1	A	protein	428	Homo sapiens	Q8N1G2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4N4A_1 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 (chains A)
GAMRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKM
IIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKMAN
MDFVFDRMFTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTL
KGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLM
ADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYC
CFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVP
LEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIP
DQARVAPS

Primary citation

Structural analysis of human 2'-O-ribose methyltransferases involved in mRNA cap structure formation. Smietanski, M., Werner, M., Purta, E. et al. Nat Commun (2014) 5:3004-3004. DOI 10.1038/ncomms4004 · PubMed

Other PDB entries of the same protein (UniProt Q8N1G2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N49 1.9 Å, Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 Protein in complex with m7GpppG…
4N48 2.7 Å, Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 Protein in complex with capped…
8P4E 3.9 Å, Structural insights into human co-transcriptional capping - structure 5
8P4F 4.0 Å, Structural insights into human co-transcriptional capping - structure 6
8W8F 4.0 Å, human co-transcriptional RNA capping enzyme RNGTT-CMTR1

Browse structure collections

About this viewer

MolViewer shows 4N4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.