4N6H: PDB entry 4N6H

1.8 A Structure of the human delta opioid 7TM receptor (PSI Community Target). Determined by X-ray diffraction at 1.8 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 3,582
Mol. weight: 52.09 kDa
Ligands: EJ4, TLA, OLC, OLA
Released: 25 Dec 2013

Explore 4N6H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N6H contains 21 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1003-1019	17
α-helix	1023-1041	19
α-helix	1046-1048	3
α-helix	1056-1080	25
α-helix	1084-1097	14
α-helix	1098-1102	5
α-helix	1103-1106	4
α-helix	40-76	37
α-helix	78-80	3
α-helix	83-100	18
α-helix	102-111	10
α-helix	118-151	34
α-helix	156-159	4
α-helix	162-186	25
β-strand	187-192	6	1
β-strand	195-200	6	1
α-helix	202	1
α-helix	206-218	13
α-helix	219-223	5
α-helix	224-242	19
α-helix	250-286	37
α-helix	294-321	28
α-helix	323-334	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562, Delta-type opioid receptor chimeric protein	A	protein	414	Escherichia coli, Homo sapiens	P0ABE7 (AlphaFold model), P41143 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4N6H_1 Soluble cytochrome b562, Delta-type opioid receptor chimeric protein (chains A)
GGTTMADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDS
PEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSPGARSAS
SLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPF
QSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAK
AKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVV
PILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVW
TLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCG

Ligands and cofactors

ID	Name	Formula	Copies
EJ4	(4bS,8R,8aS,14bR)-7-(cyclopropylmethyl)-5,6,7,8,14,14b-hexahydro-4,8-methano[1]…	C26 H26 N2 O3	1
TLA	L(+)-tartaric acid	C4 H6 O6	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	5
OLA	Oleic acid	C18 H34 O2	12

Water and common crystallization additives (NA, PGE) are not listed.

Primary citation

Molecular control of delta-opioid receptor signalling. Fenalti, G., Giguere, P.M., Katritch, V. et al. Nature (2014) 506:191-196. DOI 10.1038/nature12944 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 4N6H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.