4NFA: C-terminal doamin of Knl1

Structure of the C-terminal doamin of Knl1. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Mar 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,804
Mol. weight: 24.49 kDa
Released: 19 Mar 2014

Explore 4NFA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NFA contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2111-2114	4	1
β-strand	2120-2125	6	1
β-strand	2128-2134	7	1
β-strand	2151-2158	8	1
α-helix	2167-2184	18
α-helix	2196-2223	28
α-helix	2224-2227	4
β-strand	2229-2235	7	2
β-strand	2238-2245	8	2
β-strand	2250-2257	8	2
α-helix	2266-2268	3
β-strand	2269-2275	7	2
α-helix	2280-2289	10
α-helix	2296-2304	9
α-helix	2305-2309	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein CASC5	A	protein	207	Homo sapiens	Q8NG31 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4NFA_1 Protein CASC5 (chains A)
SLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQ
APPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFSLVVHHCRLLGEEIEYLKRWG
PNYNLMNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIA
TILSKVPLENNYLKNVVKQIYQDLFQD

Primary citation

Modular Assembly of RWD Domains on the Mis12 Complex Underlies Outer Kinetochore Organization. Petrovic, A., Mosalaganti, S., Keller, J. et al. Mol Cell (2014) 53:591-605. DOI 10.1016/j.molcel.2014.01.019 · PubMed

Other PDB entries of the same protein (UniProt Q8NG31 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SI5 2.2 Å, Kinetochore-BUBR1 kinase complex
4A1G 2.6 Å, The crystal structure of the human Bub1 TPR domain in complex with the KI motif of Knl1
4NF9 2.8 Å, Structure of the Knl1/Nsl1 complex
6CZO 2.95 Å, The KNL1-PP1 Holoenzyme
8PPR 3.0 Å, Structure of the human outer kinetochore KMN network complex
8Q5H 4.5 Å, Human KMN network (outer kinetochore)

Browse structure collections

About this viewer

MolViewer shows 4NFA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.