4A1G: Human Bub1 TPR domain
The crystal structure of the human Bub1 TPR domain in complex with the KI motif of Knl1. Determined by X-ray diffraction at 2.6 Å resolution. Released 29 Feb 2012.
- Method
- X-ray diffraction
- Resolution
- 2.6 Å
- Organism
- HOMO SAPIENS
- Chains
- 8
- Atoms
- 5,497
- Mol. weight
- 96.13 kDa
- Released
- 29 Feb 2012
Explore 4A1G in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4A1G contains 40 α-helices and 16 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 9 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-14 | 12 | |
| α-helix | 23-35 | 13 | |
| α-helix | 43-56 | 14 | |
| α-helix | 60-62 | 3 | |
| α-helix | 66-76 | 11 | |
| β-strand | 79 | 1 | 1 |
| α-helix | 82-90 | 9 | |
| β-strand | 98 | 1 | 2 |
| α-helix | 99-111 | 13 | |
| α-helix | 115-127 | 13 | |
| β-strand | 131 | 1 | 2 |
| α-helix | 133-145 | 13 | |
Chain B: 9 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-17 | 14 | |
| α-helix | 23-37 | 15 | |
| α-helix | 42-56 | 15 | |
| α-helix | 60-62 | 3 | |
| α-helix | 66-76 | 11 | |
| β-strand | 79 | 1 | 3 |
| α-helix | 82-91 | 10 | |
| β-strand | 98 | 1 | 4 |
| α-helix | 99-112 | 14 | |
| α-helix | 115-128 | 14 | |
| β-strand | 131 | 1 | 4 |
| α-helix | 133-148 | 16 | |
Chain C: 9 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-17 | 14 | |
| α-helix | 23-37 | 15 | |
| α-helix | 43-56 | 14 | |
| α-helix | 60-62 | 3 | |
| α-helix | 66-76 | 11 | |
| β-strand | 79 | 1 | 5 |
| α-helix | 82-91 | 10 | |
| β-strand | 98 | 1 | 6 |
| α-helix | 99-111 | 13 | |
| α-helix | 115-128 | 14 | |
| β-strand | 131 | 1 | 6 |
| α-helix | 133-148 | 16 | |
Chain D: 9 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-16 | 14 | |
| α-helix | 23-35 | 13 | |
| α-helix | 43-56 | 14 | |
| α-helix | 60-62 | 3 | |
| α-helix | 66-78 | 13 | |
| β-strand | 79 | 1 | 7 |
| α-helix | 82-92 | 11 | |
| β-strand | 98 | 1 | 8 |
| α-helix | 99-111 | 13 | |
| α-helix | 115-127 | 13 | |
| β-strand | 131 | 1 | 8 |
| α-helix | 133-144 | 12 | |
Chains E and H: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 177 | 1 | 1 |
| α-helix | 179-185 | 7 | |
Chain F: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 177 | 1 | 3 |
| α-helix | 179-186 | 8 | |
Chain G: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 177 | 1 | 5 |
| α-helix | 179-187 | 9 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Mitotic checkpoint serine/threonine-protein kinase BUB1 | A, B, C, D | protein | 152 | HOMO SAPIENS | O43683 (AlphaFold model) |
| Protein CASC5 | E, F, G, H | protein | 53 | HOMO SAPIENS | Q8NG31 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>4A1G_1 MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1 (chains A, B, C, D)
GPMDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLD
KKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHA
SAVLQRGIQNQAEPREFLQQQYRLFQTRLTET
Sequence of entity 2 (E, F, G, H), FASTA
>4A1G_2 PROTEIN CASC5 (chains E, F, G, H)
GPQMDLTSSHTVMITKGLLDNPISEKSTKIDTTSFLANLKLHTEDSRMKKEVN
Primary citation
Structural Analysis Reveals Features of the Spindle Checkpoint Kinase Bub1-Kinetochore Subunit Knl1 Interaction. Krenn, V., Wehenkel, A., Li, X. et al. J Cell Biol (2012) 196:451. DOI 10.1083/JCB.201110013 · PubMed
Other PDB entries of the same protein (UniProt O43683 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7B1F 1.75 Å, Orthorhombic P212121 Structure of Human Mad1 C-terminal Domain in Complex with…
- 9RJ4 1.85 Å, Bub1 kinase domain in complex with inhibitor LEI221
- 6F7B 2.0 Å, Crystal structure of the human Bub1 kinase domain in complex with BAY 1816032
- 4QPM 2.2 Å, Structure of Bub1 kinase domain
- 9RJ2 2.3 Å, Bub1 kinase domain in complex with covalent inhibitor BM047
- 4R8Q 2.31 Å, Structure and substrate recruitment of the human spindle checkpoint kinase bub1
- 5DMZ 2.4 Å, Structure of human Bub1 kinase domain phosphorylated at Ser969
- 7B1H 2.4 Å, Monoclinic P21 Structure of Human Mad1 C-terminal Domain in Complex with Phosphorylated…
- 7B1J 2.9 Å, Orthorhombic P21212 Structure of Human Mad1 C-terminal Domain in Complex with…
- 2LAH Solution NMR Structure of Mitotic checkpoint serine/threonine-protein kinase BUB1…
Browse structure collections
About this viewer
MolViewer shows 4A1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.