3SI5: Kinetochore-BUBR1 kinase complex

Kinetochore-BUBR1 kinase complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 26 Oct 2011.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,044
Mol. weight: 46.47 kDa
Released: 26 Oct 2011

Explore 3SI5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SI5 contains 22 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	55-68	14
α-helix	75-88	14
α-helix	94-96	3
α-helix	98-109	12
α-helix	113-115	3
α-helix	119-129	11
β-strand	132	1	1
α-helix	135-145	11
β-strand	151	1	2
α-helix	152-164	13
α-helix	168-180	13
β-strand	184	1	2
α-helix	186-202	17

Chain B: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	56-67	12
α-helix	74-88	15
α-helix	98-109	12
α-helix	113-115	3
α-helix	119-129	11
β-strand	132	1	3
α-helix	135-145	11
β-strand	151	1	4
α-helix	152-164	13
α-helix	168-180	13
β-strand	184	1	4
α-helix	186-199	14
α-helix	200-202	3

Chain X: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	213	1	1
α-helix	215-224	10

Chain Y: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	213	1	3
α-helix	215-223	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic checkpoint serine/threonine-protein kinase BUB1 beta	A, B	protein	176	Homo sapiens	O60566 (AlphaFold model)
Protein CASC5	X, Y	protein	24	Homo sapiens	Q8NG31 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3SI5_1 Mitotic checkpoint serine/threonine-protein kinase BUB1 beta (chains A, B)
TGSTGSTGSTGSQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLER
AVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEA
RENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESS

Sequence of entity 2 (X, Y), FASTA

>3SI5_2 Protein CASC5 (chains X, Y)
GPLGSSSENKIDFNDFIKRLKTGK

Primary citation

Structure of a Blinkin-BUBR1 Complex Reveals an Interaction Crucial for Kinetochore-Mitotic Checkpoint Regulation via an Unanticipated Binding Site. Bolanos-Garcia, V.M., Lischetti, T., Matak-Vinkovic, D. et al. Structure (2011) 19:1691-1700. DOI 10.1016/j.str.2011.09.017 · PubMed

Other PDB entries of the same protein (UniProt O60566 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WVI 1.8 Å, Crystal Structure of the N-terminal Domain of BubR1
5JJA 2.35 Å, Crystal structure of a PP2A B56gamma/BubR1 complex
4GGD 2.44 Å, Structural analysis of human Cdc20 supports multisite degron recognition by APC/C.
5K6S 2.79 Å, The structure of the PP2A B56 subunit BubR1 complex
5SWF 2.82 Å, The structure of the PP2A B56 subunit double phosphorylated BubR1 complex
6TLJ 3.8 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
5LCW 4.2 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
5KHU 4.8 Å, Model of human Anaphase-promoting complex/Cyclosome (APC15 deletion mutant), in complex…

Browse structure collections

About this viewer

MolViewer shows 3SI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.