Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 12-mer siRNA having UA-3' ends (2.1 Angstrom resolution). Determined by X-ray diffraction at 2.1 Å resolution. Released 5 Mar 2014.
Explore 4NGC in 3D Show helices and sheets RCSB PDB PDBe
4NGC contains 17 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 758-770 | 13 | 1 |
| α-helix | 771-772 | 2 | |
| α-helix | 773-775 | 3 | |
| α-helix | 780-782 | 3 | |
| α-helix | 785-787 | 3 | |
| β-strand | 791-796 | 6 | 1 |
| α-helix | 799-802 | 4 | |
| β-strand | 806-810 | 5 | 1 |
| β-strand | 813-826 | 14 | 1 |
| α-helix | 830-842 | 13 | |
| α-helix | 843-847 | 5 | |
| β-strand | 867-873 | 7 | 1 |
| β-strand | 880-882 | 3 | 1 |
| α-helix | 884-892 | 9 | |
| α-helix | 899-901 | 3 | |
| α-helix | 914-917 | 4 | |
| β-strand | 921-924 | 4 | 2 |
| α-helix | 932-934 | 3 | |
| β-strand | 935-941 | 7 | 2 |
| β-strand | 949 | 1 | 3 |
| α-helix | 950 | 1 | |
| β-strand | 957 | 1 | 3 |
| α-helix | 958-966 | 9 | |
| β-strand | 977-982 | 6 | 2 |
| α-helix | 1005-1019 | 15 | |
| β-strand | 1021-1022 | 2 | 2 |
| α-helix | 1024-1026 | 3 | |
| β-strand | 1027-1029 | 3 | 2 |
| α-helix | 1034-1040 | 7 | |
| α-helix | 1043-1051 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endoribonuclease Dicer | A | protein | 302 | Homo sapiens | Q9UPY3 (AlphaFold model) |
| 5'-r(*gp*cp*gp*ap*ap*up*up*cp*gp*cp*up*a)-3' | B | RNA | 12 |
>4NGC_1 Endoribonuclease Dicer (chains A) SDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSG EVTISIELAASGFMLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNV VNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPH RFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPR HLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC LL
>4NGC_2 5'-R(*GP*CP*GP*AP*AP*UP*UP*CP*GP*CP*UP*A)-3' (chains B) GCGAAUUCGCUA
A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer. Tian, Y., Simanshu, D.K., Ma, J.B. et al. Mol Cell (2014) 53:606-616. DOI 10.1016/j.molcel.2014.01.003 · PubMed
Other PDB entries of the same protein (UniProt Q9UPY3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.