4WYQ: Dicer-TRBP interface

Crystal structure of the Dicer-TRBP interface. Determined by X-ray diffraction at 3.2 Å resolution. Released 17 Dec 2014.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,192
Mol. weight: 47.02 kDa
Released: 17 Dec 2014

Explore 4WYQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WYQ contains 18 α-helices and 6 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	270-284	15
α-helix	299-315	17
α-helix	317-337	21
α-helix	341-363	23
α-helix	377-387	11

Chains B and E: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	294-305	12
β-strand	309-314	6	1
α-helix	317-318	2
β-strand	323-329	7	1
β-strand	335-341	7	1
α-helix	344-362	19

Chains C and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	270-284	15
α-helix	299-315	17
α-helix	317-337	21
α-helix	341-363	23
α-helix	377-388	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endoribonuclease Dicer	A, D	protein	123	Homo sapiens	Q9UPY3 (AlphaFold model)
RISC-loading complex subunit TARBP2	B, E	protein	75	Homo sapiens	Q15633 (AlphaFold model)
Poly(UNK)	C, F	protein	11	Homo sapiens

Sequence of entity 1 (A, D), FASTA

>4WYQ_1 Endoribonuclease Dicer (chains A, D)
YERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMV
RELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRK
YKP

Sequence of entity 2 (B, E), FASTA

>4WYQ_2 RISC-loading complex subunit TARBP2 (chains B, E)
ALGPACCRVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAAR
GEAARRALQYLKIMA

Sequence of entity 3 (C, F), FASTA

>4WYQ_3 Poly(UNK) (chains C, F)
XXXXXXXXXXX

Primary citation

Dicer-TRBP Complex Formation Ensures Accurate Mammalian MicroRNA Biogenesis. Wilson, R.C., Tambe, A., Kidwell, M.A. et al. Mol Cell (2015) 57:397-407. DOI 10.1016/j.molcel.2014.11.030 · PubMed

Other PDB entries of the same protein (UniProt Q9UPY3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NGD 1.96 Å, Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 12-mer…
2EB1 2.0 Å, Crystal Structure of the C-Terminal RNase III Domain of Human Dicer
4NGC 2.1 Å, Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 12-mer…
4NGB 2.25 Å, Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 12-mer…
4NH5 2.55 Å, Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 14-mer…
4NH6 2.55 Å, Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 15-mer…
4NGG 2.6 Å, Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 13-mer…
4NH3 2.62 Å, Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 13-mer…
21CB 3.0 Å, Cryo-EM structure of DICER with pre-mir-517a-GU in pre-dicing state
7XW2 3.04 Å, Cryo-EM structure of human DICER-pre-miRNA in a dicing state
4NGF 3.1 Å, Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 17-mer…
21CN 3.21 Å, Cryo-EM structure of DICER with pre-mir-517a-GU in dicing state

Browse structure collections

About this viewer

MolViewer shows 4WYQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.