4NR2: STK4 (MST1) SARAH domain

Crystal structure of STK4 (MST1) SARAH domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 8
Atoms: 3,703
Mol. weight: 50.17 kDa
Released: 29 Jan 2014

Explore 4NR2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NR2 contains 14 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, D, E and H: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	433-436	4
α-helix	441-478	38

Chains B and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	441-478	38

Chain G: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	434-438	5
α-helix	441-478	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 4	A, B, C, D, E, F, G, H	protein	51	Homo sapiens	Q13043 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>4NR2_1 Serine/threonine-protein kinase 4 (chains A, B, C, D, E, F, G, H)
SMDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

Primary citation

Crystal structure of STK4 (MST1) SARAH domain. Chaikuad, A., Krojer, T., Kopec, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q13043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PAV 1.9 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
8A5J 2.12 Å, Crystal structure of Human STE20-like kinase 1, MST1 in complex with compound XMU-MP-1
8PAW 2.14 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
3COM 2.2 Å, Crystal structure of Mst1 kinase
4OH8 2.28 Å, Crystal Structure of the human MST1-RASSF5 SARAH heterodimer
5TWG 2.3 Å, human MOB1A bound to human MST1 phosphorylated T353 peptide
9VX3 2.39 Å, Crystal structure of the peptide-bound form of HisMab-1 Fv-clasp
5TWH 2.5 Å, human MOB1A bound to MST1 phosphorylated T367 peptide
7CEA 2.55 Å, Crystal structure of HUTS-4 Fv-clasp fragment
6YAT 2.58 Å, Crystal structure of STK4 (MST1) in complex with compound 6
9IIC 2.78 Å, Crystal structure of HOIP RING2-LDD in complex with STK4 KD domain
7CEB 2.89 Å, Crystal structure of alpha6beta1 integrin headpiece

Browse structure collections

About this viewer

MolViewer shows 4NR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.