4NTJ: Human P2Y12 receptor

Structure of the human P2Y12 receptor in complex with an antithrombotic drug. Determined by X-ray diffraction at 2.62 Å resolution. Released 26 Mar 2014.

Method: X-ray diffraction
Resolution: 2.62 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 1
Atoms: 3,025
Mol. weight: 55.21 kDa
Ligands: AZJ, CLR, OLC
Released: 26 Mar 2014

Explore 4NTJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NTJ contains 22 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 0 β-strands

Element	Residues	Length
α-helix	21	1
α-helix	22-27	6
α-helix	28-50	23
α-helix	58-74	17
α-helix	77-84	8
α-helix	93-127	35
α-helix	129	1
α-helix	138-160	23
α-helix	181-1019	62
α-helix	1023-1043	21
α-helix	1045-1047	3
α-helix	1061-1081	21
α-helix	1084-1092	9
α-helix	1093-1095	3
α-helix	1097-226	13
α-helix	235-238	4
α-helix	240-248	9
α-helix	250-256	7
α-helix	258-260	3
α-helix	270-288	19
α-helix	290-301	12
α-helix	303-311	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
P2Y purinoceptor 12,Soluble cytochrome b562,P2Y purinoceptor 12	A	protein	466	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), Q9H244 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4NTJ_1 P2Y purinoceptor 12,Soluble cytochrome b562,P2Y purinoceptor 12 (chains A)
DYKDDDDGAPQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFF
QIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYIS
ISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKN
VKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTADLEDNWE
TLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDIL
VGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLRGVGKVPRKKVNVKVFIIIAVF
FICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLNPFIYFFLCKSF
RNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPMGRPLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
AZJ	ethyl 6-{4-[(benzylsulfonyl)carbamoyl]piperidin-1-yl}-5-cyano-2-methylpyridine-…	C23 H26 N4 O5 S	1
CLR	Cholesterol	C27 H46 O	2
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	2

Primary citation

Structure of the human P2Y12 receptor in complex with an antithrombotic drug. Zhang, K., Zhang, J., Gao, Z.-G. et al. Nature (2014) 509:115-118. DOI 10.1038/nature13083 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 4NTJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.