4NTW: Acid-sensing ion channel

Structure of acid-sensing ion channel in complex with snake toxin. Determined by X-ray diffraction at 2.07 Å resolution. Released 19 Feb 2014.

Method: X-ray diffraction
Resolution: 2.07 Å
Organisms: Gallus gallus, Micrurus tener tener
Chains: 3
Atoms: 5,011
Mol. weight: 73.04 kDa
Ligands: NAG
Released: 19 Feb 2014

Explore 4NTW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NTW contains 34 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	46-69	24
β-strand	74-81	8	1
β-strand	86-87	2	2
β-strand	90-95	6	3
α-helix	101-103	3
α-helix	106-112	7
α-helix	133-142	10
α-helix	155-162	8
α-helix	166-169	4
β-strand	170-175	6	1
β-strand	178-179	2	1
α-helix	182-184	3
β-strand	185-190	6	3
β-strand	193-198	6	3
α-helix	205-208	4
β-strand	209-210	2	2
α-helix	215-217	3
β-strand	219-224	6	1
α-helix	227-229	3
α-helix	231-232	2
β-strand	246-251	6	3
α-helix	259-262	4
β-strand	264-266	3	3
β-strand	270-282	13	1
α-helix	284-285	2
β-strand	292	1	4
α-helix	306-322	17
β-strand	325	1	5
α-helix	334	1
β-strand	335	1	5
α-helix	336-337	2
α-helix	338-340	3
α-helix	341-345	5
α-helix	346-354	9
α-helix	362-364	3
β-strand	365	1	4
β-strand	367-379	13	1
α-helix	383-393	11
α-helix	397-403	7
β-strand	404-411	8	1
β-strand	416-423	8	1
α-helix	427-441	15
α-helix	446-454	9

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	10-11	2
β-strand	21-27	7	6
β-strand	32-38	7	6
β-strand	48	1	6
α-helix	51-59	9

Chain C: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9
α-helix	17-19	3
β-strand	23	1	7
β-strand	27	1	7
α-helix	38-52	15
α-helix	53-57	5
β-strand	69	1	8
α-helix	74-76	3
β-strand	78	1	8
α-helix	85-103	19
β-strand	111	1	7
α-helix	115-117	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acid-sensing ion channel 1	A	protein	450	Gallus gallus	Q1XA76 (AlphaFold model)
Neurotoxin MitTx-alpha	B	protein	60	Micrurus tener tener	G9I929 (AlphaFold model)
Basic phospholipase A2 homolog Tx-beta	C	protein	119	Micrurus tener tener	G9I930 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4NTW_1 Acid-sensing ion channel 1 (chains A)
GQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLALVCTNRIQYYFLYP
HVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADE
KQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYG
KCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQ
DEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDC
ETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGK
ELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGD
IGGQMGLFIGASILTVLELFDYAYEVIKHR

Sequence of entity 2 (B), FASTA

>4NTW_2 Neurotoxin MitTx-alpha (chains B)
QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG

Sequence of entity 3 (C), FASTA

>4NTW_3 Basic phospholipase A2 homolog Tx-beta (chains C)
NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCK
PLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (P6G, NA, CL) are not listed.

Primary citation

X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel. Baconguis, I., Bohlen, C.J., Goehring, A. et al. Cell (2014) 156:717-729. DOI 10.1016/j.cell.2014.01.011 · PubMed

Other PDB entries of the same protein (UniProt Q1XA76 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QTS 1.9 Å, Structure of an acid-sensing ion channel 1 at 1.9 A resolution and low pH
4NTX 2.27 Å, Structure of acid-sensing ion channel in complex with snake toxin and amiloride
3S3W 2.6 Å, Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
4NTY 2.65 Å, Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake…
4FZ0 2.8 Å, Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low pH
6VTK 2.82 Å, Structure of an acid-sensing ion channel solubilized by styrene maleic acid and in a…
5WKU 2.95 Å, Structure of an acid sensing ion channel in a resting state with barium
3S3X 2.99 Å, Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with…
3IJ4 3.0 Å, Cesium sites in the crystal structure of a functional acid sensing ion channel in the…
4NYK 3.0 Å, Structure of a membrane protein
6X9H 3.01 Å, Molecular mechanism and structural basis of small-molecule modulation of acid-sensing…
5WKV 3.2 Å, Structure of an acid sensing ion channel in a resting state with calcium

Browse structure collections

About this viewer

MolViewer shows 4NTW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.