4NUV: Duffy receptor

Heterotetramer structure of Region II from Plasmodium vivax Duffy Binding Protein (PvDBP) bound to the ectodomain of the Duffy Antigen Receptor for Chemokines (DARC). Determined by X-ray diffraction at 2.6 Å resolution. Released 5 Feb 2014.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Plasmodium vivax, Homo sapiens
Chains: 4
Atoms: 5,164
Mol. weight: 82.66 kDa
Released: 5 Feb 2014

Explore 4NUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NUV contains 38 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	215-217	3
α-helix	221-222	2
β-strand	229	1	1
β-strand	238	1	1
α-helix	240-243	4
α-helix	248-251	4
α-helix	265-266	2
α-helix	267-271	5
α-helix	272-290	19
α-helix	297-314	18
α-helix	324-336	13
α-helix	342-351	10
α-helix	354-361	8
α-helix	363-366	4
α-helix	379-383	5
α-helix	388-415	28
β-strand	418	1	2
β-strand	424	1	2
α-helix	425-428	4
α-helix	430-462	33
α-helix	474-481	8
α-helix	487-494	8
α-helix	499-505	7

Chain B: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	215-217	3
α-helix	220-222	3
β-strand	229	1	3
β-strand	238	1	3
α-helix	240-243	4
α-helix	248-252	5
α-helix	265-290	26
α-helix	297-315	19
α-helix	324-336	13
α-helix	342-361	20
α-helix	363-369	7
α-helix	372-375	4
α-helix	379-382	4
α-helix	388-415	28
β-strand	418	1	4
β-strand	424	1	4
α-helix	425-427	3
α-helix	430-460	31
α-helix	474-481	8
α-helix	487-494	8
α-helix	499-505	7

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	22-28	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Duffy receptor	A, B	protein	317	Plasmodium vivax	P22290 (AlphaFold model)
Duffy antigen/chemokine receptor	C, D	protein	34	Homo sapiens	Q16570 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4NUV_1 Duffy receptor (chains A, B)
ASNTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVNNTDTNFHRDITFR
KLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVV
ENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLKGNFIWICKLNVAVNIEPQ
IYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKN
QWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
VEEAKKNTQEVVTNVDN

Sequence of entity 2 (C, D), FASTA

>4NUV_2 Duffy antigen/chemokine receptor (chains C, D)
GPTGTENSSQLDFEDVWNSSYGVNDSFPDGDYGA

Primary citation

Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC. Batchelor, J.D., Malpede, B.M., Omattage, N.S. et al. PLoS Pathog (2014) 10:e1003869-e1003869. DOI 10.1371/journal.ppat.1003869 · PubMed

Other PDB entries of the same protein (UniProt P22290 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EZE 1.55 Å, Structure of subdomain 3 of the Plasmodium vivx Duffy binding protein (PvDBP) bound to…
3RRC 1.95 Å, Crystal Structure of Region II from Plasmodium vivax Duffy Binding Protein
4NUU 1.95 Å, Heterotrimer structure of Region II from Plasmodium vivax Duffy Binding Protein (PvDBP)…
4YFS 2.1 Å, Structure of the synthetic Duffy Binding Protein (DBP) antigen DEKnull relevant for…
8A44 2.49 Å, Plasmodium vivax Duffy binding protein region II bound the DARC ectodomain and…
6OAN 2.9 Å, Structure of DBP in complex with human neutralizing antibody 053054
6R2S 3.04 Å, The structure of Plasmodium vivax Duffy binding protein (PvDBP) bound to human antibody…
6OAO 3.5 Å, Structure of DBP in complex with human neutralizing antibody 092096
5F3J 4.0 Å, Crystal structure of DBP in complex with inhibitory monoclonal antibody 2D10

Browse structure collections

About this viewer

MolViewer shows 4NUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.