Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 8. Determined by X-ray diffraction at 1.94 Å resolution. Released 19 Feb 2014.
Explore 4NW5 in 3D Show helices and sheets RCSB PDB PDBe
4NW5 contains 16 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 65-67 | 3 | |
| β-strand | 68-76 | 9 | 1 |
| β-strand | 81-87 | 7 | 1 |
| β-strand | 96-103 | 8 | 1 |
| α-helix | 109-124 | 16 | |
| β-strand | 130 | 1 | 2 |
| α-helix | 131-132 | 2 | |
| β-strand | 133-139 | 7 | 1 |
| β-strand | 142-148 | 7 | 1 |
| β-strand | 154 | 1 | 2 |
| α-helix | 155-162 | 8 | |
| α-helix | 167-186 | 20 | |
| β-strand | 190 | 1 | 3 |
| α-helix | 196-198 | 3 | |
| β-strand | 199-201 | 3 | 2 |
| β-strand | 207-209 | 3 | 2 |
| β-strand | 216 | 1 | 3 |
| β-strand | 225 | 1 | 4 |
| α-helix | 232-234 | 3 | |
| α-helix | 237-240 | 4 | |
| β-strand | 245 | 1 | 4 |
| α-helix | 248-263 | 16 | |
| α-helix | 273-282 | 10 | |
| α-helix | 293-302 | 10 | |
| α-helix | 307-309 | 3 | |
| α-helix | 319-322 | 4 | |
| α-helix | 325-327 | 3 | |
| α-helix | 332-336 | 5 | |
| α-helix | 341-342 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribosomal protein S6 kinase alpha-3 | A | protein | 323 | Homo sapiens | P51812 (AlphaFold model) |
>4NW5_1 Ribosomal protein S6 kinase alpha-3 (chains A) GPNPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQL YAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLF TRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSK ESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKET MTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLY RREIHPPFKPATGRPEDTFYFDP
| ID | Name | Formula | Copies |
|---|---|---|---|
| 2NR | 7-(2-fluoro-6-methoxyphenyl)-N-(3,4,5-trimethoxyphenyl)-1,3-benzoxazol-2-amine | C23 H21 F N2 O5 | 1 |
2-Amino-7-substituted benzoxazole analogs as potent RSK2 inhibitors. Costales, A., Mathur, M., Ramurthy, S. et al. Bioorg Med Chem Lett (2014) 24:1592-1596. DOI 10.1016/j.bmcl.2014.01.058 · PubMed
Other PDB entries of the same protein (UniProt P51812 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.