8XEY: C-terminal kinase domain of RSK2 from Biortus

The Crystal Structure of C-terminal kinase domain of RSK2 from Biortus. Determined by X-ray diffraction at 2.65 Å resolution. Released 6 Mar 2024.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,549
Mol. weight: 38.52 kDa
Released: 6 Mar 2024

Explore 8XEY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XEY contains 18 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	409-413	5
α-helix	418-421	4
β-strand	422-430	9	1
β-strand	434-441	8	1
β-strand	446-454	9	1
α-helix	461-470	10
β-strand	476	1	2
β-strand	479-484	6	1
β-strand	488-494	7	1
β-strand	499-500	2	2
α-helix	501-506	6
α-helix	513-532	20
β-strand	535-536	2	3
α-helix	542-544	3
β-strand	545-547	3	2
α-helix	554-556	3
β-strand	557-559	3	2
β-strand	566-567	2	3
α-helix	571-573	3
α-helix	591-613	23
α-helix	626-635	10
α-helix	643-646	4
α-helix	650-660	11
α-helix	668-669	2
α-helix	670-673	4
α-helix	677-680	4
α-helix	682-684	3
α-helix	689-690	2
α-helix	696-710	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein S6 kinase alpha-3	A	protein	341	Homo sapiens	P51812 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8XEY_1 Ribosomal protein S6 kinase alpha-3 (chains A)
QTVGVHSIVQQLHRNSIQFTDGYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRD
PTEEIEILLRYGQHPNIITLKDVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAV
LFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPC
YTANFVAPEVLERQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFS
LSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLV
KGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL

Primary citation

The Crystal Structure of C-terminal kinase domain of RSK2 from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.

Other PDB entries of the same protein (UniProt P51812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NW6 1.74 Å, Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 27
8EQ5 1.8 Å, Crystal structure of the N-terminal kinase domain of RSK2 in complex with SPRED2 (131-160)
4NW5 1.94 Å, Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 8
5D9L 2.15 Å, Rsk2 N-terminal Kinase in Complex with bis-phenol pyrazole
8R58 2.31 Å, The RSK 2 N-terminal kinase domain in complex with BMF (1-19)
4NUS 2.39 Å, Rsk2 N-terminal kinase in complex with LJH685
4D9T 2.4 Å, Rsk2 C-terminal Kinase Domain with inhibitor (E)-methyl…
4D9U 2.4 Å, Rsk2 C-terminal Kinase Domain, (E)-tert-butyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H…
5D9K 2.55 Å, Rsk2 N-terminal Kinase in Complex with BI-D1870
4JG6 2.6 Å, RSK2 CTD bound to 2-cyano-3-(1H-indazol-5-yl)acrylamide
7OPO 2.75 Å, RSK2 N-terminal kinase domain in complex with ORF45
4JG7 3.0 Å, Structure of RSK2 CTD bound to 3-(3-(1H-pyrrolo[2,3-b]pyridine-3-carbonyl)phenyl)-2-cyano…

Browse structure collections

About this viewer

MolViewer shows 8XEY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.