4O46: 14-3-3-gamma

14-3-3-gamma in complex with influenza NS1 C-terminal tail phosphorylated at S228. Determined by X-ray diffraction at 2.9 Å resolution. Released 30 Apr 2014.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Homo sapiens, Influenza A virus H3N2
Chains: 16
Atoms: 10,919
Mol. weight: 196.44 kDa
Released: 30 Apr 2014

Explore 4O46 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4O46 contains 82 α-helices and 0 β-strands across 11 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-73	35
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-137	21
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-206	17
α-helix	208-210	3
α-helix	216-233	18

Chain F: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-72	34
α-helix	78-103	26
α-helix	104-108	5
α-helix	119-136	18
α-helix	143-160	18
α-helix	172-181	10
α-helix	182-186	5
α-helix	190-203	14
α-helix	216-234	19

Chain K: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	226-229	4

Chain M: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-24	18

Chain N: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-17	7

Chain O: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-18	8

Chain V: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein gamma	A, B, C, D, E, F	protein	256	Homo sapiens	P61981 (AlphaFold model)
Nonstructural protein 1	G, H, I, J, K, L	protein	15	Influenza A virus H3N2	Q9YP60
Unidentified polymer	M, N, O, V	protein	24	Homo sapiens

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>4O46_1 14-3-3 protein gamma (chains A, B, C, D, E, F)
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNNSLEHHHHHH

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>4O46_2 Nonstructural protein 1 (chains G, H, I, J, K, L)
PKQKRKMARTARSKV

Sequence of entity 3 (M, N, O, V), FASTA

>4O46_3 Unidentified polymer (chains M, N, O, V)
XXXXXXXXXXXXXXXXXXXXXXXX

Primary citation

Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1. Qin, S., Liu, Y., Tempel, W. et al. Nat Commun (2014) 5:3952-3952. DOI 10.1038/ncomms4952 · PubMed

Other PDB entries of the same protein (UniProt P61981 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S9K 1.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 peptide containing 14-3-3 binding…
6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
3UZD 1.86 Å, Crystal structure of 14-3-3 GAMMA
6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
6A5S 2.1 Å, Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif
4E2E 2.25 Å, Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation…
7A6Y 2.5 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide stabilized by FC-A
2B05 2.55 Å, Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide
6GKF 2.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139
6BZD 2.67 Å, Structure of 14-3-3 gamma R57E mutant bound to GlcNAcylated peptide
7A6R 2.7 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide containing the 14-3-3 binding…
5D3E 2.75 Å, Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795

Browse structure collections

About this viewer

MolViewer shows 4O46 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.