4O7Q: Interferon-inducible protein AIM2

Crystal Structure of the F27G AIM2 Pyrin Domain Mutant and Similarities of its Self-association to DED/DED Interactions. Determined by X-ray diffraction at 1.82 Å resolution. Released 19 Feb 2014.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: Homo sapiens
Chains: 1
Atoms: 830
Mol. weight: 10.84 kDa
Released: 19 Feb 2014

Explore 4O7Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4O7Q contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	1-7	7
α-helix	8-13	6
α-helix	14-16	3
α-helix	19-29	11
α-helix	37-40	4
α-helix	45-56	12
α-helix	58-71	14
α-helix	75-91	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-inducible protein AIM2	A	protein	94	Homo sapiens	O14862 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4O7Q_1 Interferon-inducible protein AIM2 (chains A)
AMESKYKEILLLTGLDNITDEELDRFKGFLSDEFNIATGKLHTANRIQVATLMIQNAGAV
SAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYK

Primary citation

Crystal Structure of the F27G AIM2 PYD Mutant and Similarities of Its Self-Association to DED/DED Interactions. Lu, A., Kabaleeswaran, V., Fu, T. et al. J Mol Biol (2014) 426:1420-1427. DOI 10.1016/j.jmb.2013.12.029 · PubMed

Other PDB entries of the same protein (UniProt O14862 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VD8 2.07 Å, Crystal structure of human AIM2 PYD domain with MBP fusion
3RN5 2.5 Å, Structural basis of cytosolic DNA recognition by innate immune receptors
3RN2 2.55 Å, Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors
7K3R 3.2 Å, Cryo-EM structure of AIM2-PYD filament
6MB2 5.0 Å, Cryo-EM structure of the PYD filament of AIM2

Browse structure collections

About this viewer

MolViewer shows 4O7Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.