4O9R: Human Smoothened Receptor structure

Human Smoothened Receptor structure in complex with cyclopamine. Determined by X-ray diffraction at 3.2 Å resolution. Released 5 Mar 2014.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 1
Atoms: 3,419
Mol. weight: 52.81 kDa
Ligands: CY8
Released: 5 Mar 2014

Explore 4O9R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4O9R contains 20 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	197-199	3	1
α-helix	203-205	3
β-strand	213-215	3	1
β-strand	216	1	2
α-helix	224-252	29
α-helix	256-258	3
α-helix	264-282	19
α-helix	283-285	3
α-helix	289-294	6
β-strand	295	1	3
β-strand	300	1	2
β-strand	301	1	3
β-strand	305	1	4
α-helix	313-340	28
α-helix	361-378	18
β-strand	381-384	4	4
β-strand	389-392	4	4
α-helix	397-400	4
α-helix	401-405	5
α-helix	406-1019	47
α-helix	1023-1041	19
α-helix	1046-1048	3
α-helix	1056-1079	24
α-helix	1084-1101	18
α-helix	447-475	29
α-helix	477-492	16
α-helix	515-532	18
α-helix	533-536	4
α-helix	541-548	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Smoothened homolog/Soluble cytochrome b562 chimeric protein	A	protein	468	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), Q99835 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4O9R_1 Smoothened homolog/Soluble cytochrome b562 chimeric protein (chains A)
GGTSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTL
FTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEP
TSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWS
LPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTL
FSIKSNHADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSP
DSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLAASKINE
TMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDC
EIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQ

Ligands and cofactors

ID	Name	Formula	Copies
CY8	Cyclopamine	C27 H41 N O2	1

Primary citation

Lipidic cubic phase injector facilitates membrane protein serial femtosecond crystallography. Weierstall, U., James, D., Wang, C. et al. Nat Commun (2014) 5:3309-3309. DOI 10.1038/ncomms4309 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 4O9R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.