4OEG: Fibroblast growth factor 2

Crystal Structure Analysis of FGF2-Disaccharide (S9I2) complex. Determined by X-ray diffraction at 1.6 Å resolution. Released 9 Jul 2014.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,151
Mol. weight: 17.94 kDa
Released: 9 Jul 2014

Explore 4OEG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OEG contains 6 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	21-25	5	1
α-helix	30	1
β-strand	31-34	4	1
β-strand	40-43	4	1
α-helix	49-51	3
β-strand	53-59	7	1
β-strand	62-67	6	1
β-strand	72-76	5	1
β-strand	82-85	4	1
α-helix	90-92	3
β-strand	94-98	5	1
β-strand	104-108	5	1
β-strand	115	1	1
β-strand	118	1	2
β-strand	123	1	1
β-strand	124	1	2
α-helix	125-126	2
α-helix	127-129	3
α-helix	135-137	3
β-strand	139-142	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibroblast growth factor 2	A	protein	155	Homo sapiens	P09038 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4OEG_1 Fibroblast growth factor 2 (chains A)
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI
KLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKY
TSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Primary citation

Interactions that influence the binding of synthetic heparan sulfate based disaccharides to fibroblast growth factor-2. Li, Y.C., Ho, I.H., Ku, C.C. et al. ACS Chem Biol (2014) 9:1712-1717. DOI 10.1021/cb500298q · PubMed

Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OM6 1.31 Å, Crystal structure of FGF2-STAB, a stable variant of human fibroblast growth factor 2
8HU7 1.4 Å, Crystal structure of FGF2-M1 mutant - D28E/C78L/C96I/S137P
8HUE 1.48 Å, Crystal structure of FGF2-M2 mutant - D28E/C78I/C96I/S137P
4OEE 1.5 Å, Crystal Structure Analysis of FGF2-Disaccharide (S3I2) complex
1BFG 1.6 Å, Crystal structure of basic fibroblast growth factor at 1.6 Å resolution
4FGF 1.6 Å, Refinement of the structure of human basic fibroblast growth factor at 1.6 Å resolution…
2FGF 1.77 Å, Three-dimensional structure of human basic fibroblast growth factor, A structural…
4OEF 1.8 Å, Crystal Structure Analysis of FGF2-Disaccharide (S6I2) complex
1BAS 1.9 Å, Three-dimensional structures of acidic and basic fibroblast growth factors
1BFB 1.9 Å, Basic fibroblast growth factor complexed with heparin tetramer fragment
5X1O 1.9 Å, PI(4,5)P2 lipid binding induced a reorientation of FGF2 molecules near membrane surface…
1BFF 2.0 Å, The 154 amino acid form of human basic fibroblast growth factor

Browse structure collections

About this viewer

MolViewer shows 4OEG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.